Property Summary

NCBI Gene PubMed Count 28
Grant Count 25
R01 Count 12
Funding $2,511,929.65
PubMed Score 94.65
PubTator Score 54.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 6.200 0.000
active Crohn's disease 1.544 0.008
lung carcinoma 3.200 0.000

Gene RIF (19)

PMID Text
26338179 VMAT1 and VMAT2 are expressed in the majority of neuroblastomas
25842846 SLC18A1 gene polymorphisms are associated with the risk of paranoid schizophrenia in Russians and Tatars.
23337945 The data of this study showed that VMAT1 polymorphisms influence monoamine signaling, the functional response of emotional brain circuits and risk for psychopathology.
23090274 Deletion of amino acids 307-338 in hVMAT1 isoform-b abolishes transport activity, and a 136-Thr partially reduces activity of isoform-a.
21883697 we found a significant down-regulation of the gene coding for the vesicular monoamine transporter (VMAT1)in enteroendocrine cells infected with Chlamydia trachomatis
20677014 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18702937 Observational study of gene-disease association. (HuGE Navigator)
18451639 Polymorphism in VMAT1 gene on chromosome 8p is associated with schizophrenia.
More...

AA Sequence

MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSSLHLGHAGSSP      1 - 70
HALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVG     71 - 140
VLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVA    141 - 210
GLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQP    211 - 280
SKVSPESAKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYL    281 - 350
IGTNLFGVLANKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL    351 - 420
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAI    421 - 490
LSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE                                       491 - 525
//

Text Mined References (30)

PMID Year Title
26338179 2016 Vesicular monoamine transporter protein expression correlates with clinical features, tumor biology, and MIBG avidity in neuroblastoma: a report from the Children's Oncology Group.
25842846 [The association of polymorphisms in SLC18A1, TPH1 and RELN genes with risk of paranoid schizophrenia].
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23337945 2014 Functional genetic variants in the vesicular monoamine transporter 1 modulate emotion processing.
23090274 2012 Thr136Ile polymorphism of human vesicular monoamine transporter-1 (SLC18A1 gene) influences its transport activity in vitro.
21883697 2011 Infection of human enteroendocrine cells with Chlamydia trachomatis: a possible model for pathogenesis in irritable bowel syndrome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
More...