Property Summary

Ligand Count 1
NCBI Gene PubMed Count 31
PubMed Score 96.17
PubTator Score 54.04

Knowledge Summary


No data available



  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.544 8.4e-03
lung cancer 1.800 1.3e-03
lung carcinoma 3.200 1.4e-55

Gene RIF (22)

AA Sequence

LSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE                                       491 - 525

Text Mined References (33)

PMID Year Title