Property Summary

NCBI Gene PubMed Count 38
PubMed Score 1058.70
PubTator Score 123.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
acute myeloid leukemia 785 0.00481821441501762
Disease Target Count Z-score Confidence
Leukodystrophy 30 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 5.084 2.5
Anemia 252 4.709 2.4
Hemorrhagic disease 11 4.018 2.0
Common cold 63 3.49 1.7
Disease Target Count
Leukodystrophy, hypomyelinating, 9 1

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.700 0.005

Synonym

Accession P54136 B2RBS9 Q53GY4 Q9BWA1
Symbols HLD9
ArgRS
DALRD1

Gene

PDB

4R3Z   4Q2T   4Q2X   4Q2Y   4ZAJ  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
25724651 Data indicate that the N terminus of Pro-EMAP II binds to its C terminus, arginyl-tRNA synthetase, and the neurofilament light subunit.
25288775 interactions between the N-terminal domains of ArgRS and AIMP1 are important for the catalytic and noncatalytic activities of ArgRS and for the assembly of the higher-order MSC protein complex with ArgRS-GlnRS-AIMP1
25010285 Interaction of HIV-1 Gag with arginyl-tRNA synthetase (RARS) is identified in a series of six affinity purification/mass spectrometry screens
24898251 The mRNA of human cytoplasmic arginyl-tRNA synthetase recruits prokaryotic ribosomes independently.
24859084 The crystal structures of the L-arginine-complexed, and L-canavanine-complexed forms of arginyl-tRNA synthetase from Homo sapiens.
24777941 report describe 4 patients with hypomyelination and mutations in RARS
22190034 Interaction of HIV-1 Gag with arginyl-tRNA synthetase (RARS) is identified in a series of six affinity purification/mass spectrometry screens
20923763 Hemin binds to human cytoplasmic arginyl-tRNA synthetase and inhibits its catalytic activity
20877624 Observational study of gene-disease association. (HuGE Navigator)
17443684 RARS over-expression impairs aminoacyl t-RNA synthetase interacting multifunctional protein (AIMP1) secretion by both HeLa and MCF7 cells.
More...

AA Sequence

MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPT      1 - 70
KNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAEN     71 - 140
ITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVG    141 - 210
HLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRF    211 - 280
DTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE    281 - 350
DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF    351 - 420
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEE    421 - 490
LNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAAR    491 - 560
ETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKV    561 - 630
NMWRMLLCEAVAAVMAKGFDILGIKPVQRM                                            631 - 660
//

Text Mined References (46)

PMID Year Title
25724651 2015 The N terminus of pro-endothelial monocyte-activating polypeptide II (EMAP II) regulates its binding with the C terminus, arginyl-tRNA synthetase, and neurofilament light protein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25288775 2014 Structure of the ArgRS-GlnRS-AIMP1 complex and its implications for mammalian translation.
24898251 2014 The mRNA of human cytoplasmic arginyl-tRNA synthetase recruits prokaryotic ribosomes independently.
24859084 2014 The crystal structure of arginyl-tRNA synthetase from Homo sapiens.
24777941 2014 Mutations in RARS cause hypomyelination.
24656866 2014 Mutations in QARS, encoding glutaminyl-tRNA synthetase, cause progressive microcephaly, cerebral-cerebellar atrophy, and intractable seizures.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...