Property Summary

Ligand Count 2
NCBI Gene PubMed Count 42
PubMed Score 1085.23
PubTator Score 123.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.700 4.8e-03

Protein-protein Interaction (11)

Gene RIF (12)

AA Sequence

MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPT      1 - 70
KNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAEN     71 - 140
ITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVG    141 - 210
HLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRF    211 - 280
DTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE    281 - 350
DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF    351 - 420
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEE    421 - 490
LNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAAR    491 - 560
ETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKV    561 - 630
NMWRMLLCEAVAAVMAKGFDILGIKPVQRM                                            631 - 660
//

Text Mined References (50)

PMID Year Title