Property Summary

NCBI Gene PubMed Count 38
Grant Count 278
R01 Count 217
Funding $28,558,689.58
PubMed Score 1058.70
PubTator Score 123.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.700 0.005

Synonym

Accession P54136 B2RBS9 Q53GY4 Q9BWA1
Symbols HLD9
ArgRS
DALRD1

Gene

PDB

4R3Z   4Q2T   4Q2X   4Q2Y   4ZAJ  

Gene RIF (11)

PMID Text
25724651 Data indicate that the N terminus of Pro-EMAP II binds to its C terminus, arginyl-tRNA synthetase, and the neurofilament light subunit.
25288775 interactions between the N-terminal domains of ArgRS and AIMP1 are important for the catalytic and noncatalytic activities of ArgRS and for the assembly of the higher-order MSC protein complex with ArgRS-GlnRS-AIMP1
25010285 Interaction of HIV-1 Gag with arginyl-tRNA synthetase (RARS) is identified in a series of six affinity purification/mass spectrometry screens
24898251 The mRNA of human cytoplasmic arginyl-tRNA synthetase recruits prokaryotic ribosomes independently.
24859084 The crystal structures of the L-arginine-complexed, and L-canavanine-complexed forms of arginyl-tRNA synthetase from Homo sapiens.
24777941 report describe 4 patients with hypomyelination and mutations in RARS
22190034 Interaction of HIV-1 Gag with arginyl-tRNA synthetase (RARS) is identified in a series of six affinity purification/mass spectrometry screens
20923763 Hemin binds to human cytoplasmic arginyl-tRNA synthetase and inhibits its catalytic activity
20877624 Observational study of gene-disease association. (HuGE Navigator)
17443684 RARS over-expression impairs aminoacyl t-RNA synthetase interacting multifunctional protein (AIMP1) secretion by both HeLa and MCF7 cells.
More...

AA Sequence

MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPT      1 - 70
KNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAEN     71 - 140
ITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVG    141 - 210
HLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRF    211 - 280
DTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE    281 - 350
DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF    351 - 420
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEE    421 - 490
LNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAAR    491 - 560
ETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKV    561 - 630
NMWRMLLCEAVAAVMAKGFDILGIKPVQRM                                            631 - 660
//

Text Mined References (46)

PMID Year Title
25724651 2015 The N terminus of pro-endothelial monocyte-activating polypeptide II (EMAP II) regulates its binding with the C terminus, arginyl-tRNA synthetase, and neurofilament light protein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25288775 2014 Structure of the ArgRS-GlnRS-AIMP1 complex and its implications for mammalian translation.
24898251 2014 The mRNA of human cytoplasmic arginyl-tRNA synthetase recruits prokaryotic ribosomes independently.
24859084 2014 The crystal structure of arginyl-tRNA synthetase from Homo sapiens.
24777941 2014 Mutations in RARS cause hypomyelination.
24656866 2014 Mutations in QARS, encoding glutaminyl-tRNA synthetase, cause progressive microcephaly, cerebral-cerebellar atrophy, and intractable seizures.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...