Property Summary

NCBI Gene PubMed Count 45
Grant Count 3
R01 Count 3
Funding $202,805.66
PubMed Score 42.22
PubTator Score 46.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P54108 A8K9S1 B2R8I8 Q15512 Q3MJ82 Q53FA9 Q5JW83 Q9H108 CRISP-3
Symbols Aeg2
CRS3
SGP28
CRISP-3
dJ442L6.3

Gene

PANTHER Protein Class (1)

Gene RIF (24)

PMID Text
26369530 results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression
25715794 These data suggest roles for epithelial and neutrophil-derived CRISP3 in postmenstrual endometrial repair and regeneration
24978310 up-regulation of the mRNA encoding cysteine-rich secretory protein 3 (CRISP3), a glycoprotein with unknown function that is secreted from multiple exocrine glands, was correlated with HCV resistance.
23375721 terminal beta-strands of PSP94 contact the first alpha-helix and the hinge region of CRISP-3
23196798 Strong CRISP3 expression is associated with unfavorable tumor phenotype and early recurrence in prostate cancers
22993349 MSMB and CRISP3 were widely distributed in ovaries and in ovarian tumors; the expression of MSMB fits well with a tumor-suppressor function in ovarian carcinogenesis.
21814574 up-regulation of CRISP3 is associated with prostate carcinomas with the TMPRSS2-ERG fusion gene.
21240253 We found no correlation between CRISP3 expression and biochemical recurrence.
20680031 Expression levels of AR and CRISP3 were not affected by short-term ADT but were high in castration-resistant prostate cancer (CRPC) and metastases.
20676114 Either PSP94 or CRISP-3 alone can induce growth inhibition in prostate cancer cells in a cell line specific manner.
More...

AA Sequence

MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAA      1 - 70
ANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYT     71 - 140
QVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYE    141 - 210
DLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY                                       211 - 245
//

Text Mined References (46)

PMID Year Title
27579896 2016 A 7-Gene Signature Depicts the Biochemical Profile of Early Prefibrotic Myelofibrosis.
27440996 2016 Variation in PTCHD2, CRISP3, NAP1L4, FSCB, and AP3B2 associated with spherical equivalent.
27284364 2016 Prognostic value of ERG, PTEN, CRISP3 and SPINK1 in predicting biochemical recurrence in prostate cancer.
26369530 2016 Cysteine-rich secretory protein 3 plays a role in prostate cancer cell invasion and affects expression of PSA and ANXA1.
26112483 From the epididymis to the egg: participation of CRISP proteins in mammalian fertilization.
25715794 2015 Endometrial CRISP3 is regulated throughout the mouse estrous and human menstrual cycle and facilitates adhesion and proliferation of endometrial epithelial cells.
24978310 2014 Cysteine-rich secretory protein 3 inhibits hepatitis C virus at the initial phase of infection.
24606912 2014 Cysteine- rich secretory protein 3 (CRISP3), ERG and PTEN define a molecular subtype of prostate cancer with implication to patients' prognosis.
24573035 2014 Eukaryotic expression, purification and structure/function analysis of native, recombinant CRISP3 from human and mouse.
23556447 2013 Genes involved in hemorrhagic transformations that follow recombinant t-PA treatment in stroke patients.
More...