Property Summary

NCBI Gene PubMed Count 45
PubMed Score 43.24
PubTator Score 46.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis 1.600 4.6e-02
chronic rhinosinusitis 2.402 3.8e-02
ductal carcinoma in situ 3.600 3.2e-02
esophageal adenocarcinoma -4.400 2.1e-02
interstitial cystitis -5.800 1.5e-04
intraductal papillary-mucinous adenoma (... -4.800 7.0e-04
lung cancer 1.600 1.9e-02
malignant mesothelioma 1.500 7.7e-05
mucosa-associated lymphoid tissue lympho... 4.624 1.4e-02
non primary Sjogren syndrome sicca 1.300 3.1e-02
osteosarcoma -8.231 3.8e-10
ovarian cancer -2.200 2.8e-02
psoriasis -1.200 6.8e-04
urothelial carcinoma -3.800 2.6e-02

Synonym

Accession P54108 A8K9S1 B2R8I8 Q15512 Q3MJ82 Q53FA9 Q5JW83 Q9H108 CRISP-3
Symbols Aeg2
CRS3
SGP28
CRISP-3
dJ442L6.3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (24)

AA Sequence

MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAA      1 - 70
ANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYT     71 - 140
QVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYE    141 - 210
DLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY                                       211 - 245
//

Text Mined References (46)

PMID Year Title