Property Summary

NCBI Gene PubMed Count 13
PubMed Score 51.84
PubTator Score 38.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (3)

AA Sequence

MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEE      1 - 70
AAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITT     71 - 140
DHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNP    141 - 210
CIYYDEYFDCDIQVHYLGCNHSTTILFCKATCLCDTEIK                                   211 - 249
//

Text Mined References (14)

PMID Year Title