Property Summary

NCBI Gene PubMed Count 13
Grant Count 48
R01 Count 21
Funding $10,994,479.22
PubMed Score 48.27
PubTator Score 38.28

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
24334245 Epididymal CRISP1 mediates sperm-zona pellucida binding through its interaction with ZP3.
23987519 Seminal CRISP1 combined with neutral alpha glucosidase activity can potentially distinguish between obstructive and nonobstructive azoospermia.
20378925 CRISP1 was in the seminal plasma of normal and vasovasostomized men, but not in that of vasectomized men. The soluble concentration of CRISP1 was significantly higher in the seminal plasma of vasovasostomized men as compared with that from normal men.

AA Sequence

MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEE      1 - 70
AAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITT     71 - 140
DHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNP    141 - 210
CIYYDEYFDCDIQVHYLGCNHSTTILFCKATCLCDTEIK                                   211 - 249
//

Text Mined References (14)

PMID Year Title
24334245 2014 Human fertilization: epididymal hCRISP1 mediates sperm-zona pellucida binding through its interaction with ZP3.
23987519 2013 Cysteine-rich secretory protein 1 in seminal plasma: potential biomarker for the distinction between obstructive and nonobstructive azoospermia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20378925 Vasectomy affects cysteine-rich secretory protein expression along the human epididymis and its association with ejaculated spermatozoa following vasectomy surgical reversal.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206465 The molecular basis of sperm-oocyte membrane interactions during mammalian fertilization.
11750738 Molecular mechanisms involved in mammalian gamete fusion.
11566719 2001 Evidence that human epididymal protein ARP plays a role in gamete fusion through complementary sites on the surface of the human egg.
More...