Property Summary

NCBI Gene PubMed Count 34
Grant Count 5
R01 Count 5
Funding $184,886.45
PubMed Score 51.60
PubTator Score 40.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P54105 B2RCS9 Q0VDK6 Q9NRD2 Q9NRD3
Symbols CLCI
ICln
CLNS1B

Gene

PANTHER Protein Class (1)

Gene RIF (9)

PMID Text
24298023 the S. pombe ICln protein is required for optimal production of the spliceosomal snRNPs and for efficient splicing in vivo
21917931 functional interaction between ICln and HSPC038
21081503 RioK1, a new interactor of protein arginine methyltransferase 5 (PRMT5), competes with pICln for binding and modulates PRMT5 complex composition and substrate specificity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of chloride channel, nucleotide-sensitive, 1A (CLNS1A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16087681 Lsm10 and Lsm11, which replace the Sm proteins D1 and D2 in the histone RNA processing U7 snRNPs, associate with pICln in vitro and in vivo without receiving sDMA modifications and with PRMT5 and SMN complexes
15905169 Data show that ICln159, a truncated ICln mutant, belongs to the pleckstrin homology (PH) domain family of proteins and interacts with LSm4, a protein involved in splicing and mRNA degradation.
15075326 ICln interacts with integrin alphaIIbbeta3 and regulates platelet activation.
14960305 revealed an increase of ICln in the mesothelioma cell membrane under hypotonic conditions, an event possibly related to the activation of Cl(-) channels

AA Sequence

MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDR      1 - 70
SDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPE     71 - 140
DEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDS    141 - 210
IRDYEDGMEVDTTPTVAGQFEDADVDH                                               211 - 237
//

Text Mined References (49)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24298023 2014 Characterization and in vivo functional analysis of the Schizosaccharomyces pombe ICLN gene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21917931 2011 The molecular and functional interaction between ICln and HSPC038 proteins modulates the regulation of cell volume.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...