Property Summary

NCBI Gene PubMed Count 49
Grant Count 37
R01 Count 21
Funding $4,384,044.04
PubMed Score 246.56
PubTator Score 154.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.753 0.005
osteosarcoma 1.919 0.000
astrocytoma -2.200 0.001
glioblastoma -1.600 0.048
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -1.700 0.000
hereditary spastic paraplegia -1.106 0.039
primary pancreatic ductal adenocarcinoma 1.229 0.002
tuberculosis and treatment for 6 months 1.800 0.000
lung cancer -1.500 0.016
Parkinson's disease -1.400 0.017
Breast cancer 3.200 0.028
primary Sjogren syndrome 1.100 0.024
psoriasis 1.200 0.000
Pneumonia -1.700 0.015
nasopharyngeal carcinoma 1.300 0.001
Pick disease -1.400 0.005
ovarian cancer -1.800 0.000
pancreatic cancer 1.100 0.003

Gene RIF (22)

PMID Text
26777301 PC4 associates with Aurora A and Aurora B and undergoes phosphorylation, following which PC4 activates both Aurora A and B to sustain optimal kinase activity to maintain the phosphorylation gradient for the proper functioning of the mitotic machinery.
26350217 SMYD3 interacts with the human positive coactivator 4 (PC4) and that such interaction potentiates a group of genes whose expression is linked to cell proliferation and invasion.
25961912 PC4 has similar functions to RPA in binding ssDNA to promote genome stability, especially at sites of replication-transcription collisions.
25813861 Sub1, and its human homolog PC4, bind preferentially to G-quadruplexes
25321468 PC4 protects esophageal squamous cell carcinoma cells from IR-induced death by enhancing the nonhomologous end joining-promoting activity of XLF.
25262015 expression of PC4 in astrocytoma was upregulated as assessed by western blot and immunohistochemical staining. Moreover, elevated PC4 expression was strongly correlated with the progression of astrocytoma and overall survival.
22174317 HIV-1 Rev interacting protein, SUB1 homolog (positive cofactor 4), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21586571 acetylation of lysine 382/381 of p53 may play an important role in modulating p53-PC4 interaction and as a consequence PC4 mediated activation of p53 target genes.
21193408 findings demonstrated a critical aspect of LHR modulation whereby PC4 acts as a coactivator of Sp1 to contribute to the human of LHR transcription
20305379 Sub1/PC4 a chromatin associated protein with multiple functions in transcription.
More...

AA Sequence

MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR      1 - 70
YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL                  71 - 127
//

Text Mined References (62)

PMID Year Title
26777301 2016 Multifunctional human transcriptional coactivator protein PC4 is a substrate of Aurora kinases and activates the Aurora enzymes.
26350217 2015 Cooperation between SMYD3 and PC4 drives a distinct transcriptional program in cancer cells.
25961912 2016 PC4 promotes genome stability and DNA repair through binding of ssDNA at DNA damage sites.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25813861 2015 Yeast transcription co-activator Sub1 and its human homolog PC4 preferentially bind to G-quadruplex DNA.
25321468 2014 Inhibition of human positive cofactor 4 radiosensitizes human esophageal squmaous cell carcinoma cells by suppressing XLF-mediated nonhomologous end joining.
25262015 2014 Human positive coactivator 4 (PC4) is involved in the progression and prognosis of astrocytoma.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...