Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.20
PubTator Score 8.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.100 0.011
osteosarcoma -1.124 0.006
astrocytoma 1.300 0.005
intraductal papillary-mucinous adenoma (... 1.100 0.000
ovarian cancer 1.900 0.000

Synonym

Accession P53992 B4DZT4 Q8WV25
Symbols

Gene

PDB

3EH2  

 GO Function (1)

Gene RIF (7)

PMID Text
23658022 Data indicate that a synthetic polypeptide containing the N terminus of bovine AE1 bound the Sec23A-Sec24C complex through a selective interaction with Sec24C.
23288844 a lysine residing in the C terminus of the serotonin transporter specifies its preference for the coat protein complex II component SEC24C
22404651 A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and export
21454670 The serotonin transporter is an exclusive client of the coat protein complex II (COPII) component SEC24C
18329616 We found that Sec24C, a component of the host COPII vesicular transport system, interacts specifically with VP40 via VP40 amino acids 303 to 307.
17373700 Observational study of gene-disease association. (HuGE Navigator)
15013749 The interphase form of Sec24Cp was O-N-acetylglucosamine modified, a feature lost upon entering into mitosis. This mitotic deglycosylation was coupled to Sec24p phosphorylation, a process which may contribute to observed mitotic ER-to-Golgi traffic block.

AA Sequence

MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPGYQQTPPQGMSRAPPSSGAPP      1 - 70
ASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQPPVLQPYGPPPTSAQVATQL     71 - 140
SGMQISGAVAPAPPSSGLGFGPPTSLASASGSFPNSGLYGSYPQGQAPPLSQAQGHPGIQTPQRSAPSQA    141 - 210
SSFTPPASGGPRLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQP    211 - 280
QQNGSFGPARGPQSNYGGPYPAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVR    281 - 350
GQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES    351 - 420
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATV    421 - 490
DYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGAEESAIRVGFVTYNKVLHFYN    491 - 560
VKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEAL    561 - 630
KAAECAGKLFLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFP    631 - 700
NQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAF    701 - 770
YMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR    771 - 840
NCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNC    841 - 910
VLKSDVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTEPPAVRASEERLSNGDI    911 - 980
YLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLT    981 - 1050
VVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS                             1051 - 1094
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23658022 2013 A new class of endoplasmic reticulum export signal PhiXPhiXPhi for transmembrane proteins and its selective interaction with Sec24C.
23288844 2013 Switching the clientele: a lysine residing in the C terminus of the serotonin transporter specifies its preference for the coat protein complex II component SEC24C.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22404651 2012 A triple arg motif mediates ?(2B)-adrenergic receptor interaction with Sec24C/D and export.
21454670 2011 The serotonin transporter is an exclusive client of the coat protein complex II (COPII) component SEC24C.
21269460 2011 Initial characterization of the human central proteome.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
More...