Property Summary

NCBI Gene PubMed Count 45
Grant Count 20
R01 Count 12
Funding $3,492,405.04
PubMed Score 0.00
PubTator Score 26.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.517 0.000
astrocytoma 1.300 0.023
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.200 0.000
breast carcinoma 1.100 0.024
ovarian cancer -1.500 0.000

Gene RIF (16)

PMID Text
26011858 Structural and biochemical studies reveal an unusually tight interaction between ULK3 and IST1, an ESCRT-III subunit required for cytokinetic abscission.
25657007 Crystal structures of three molecular complexes reveal that IST1 binds to the MIT domains of VPS4 and LIP5.
24880589 Findings indicate that a high expression level of overexpressed in lung cancer 1 (OLC1) serves as a biomarker for poor prognosis for breast cancer, suggesting that OLC1 may be a potential target of antiangiogenic therapy for breast cancer.
24608342 Overexpression of OLC1 promotes tumorigenesis of human esophageal squamous cell carcinoma.
24403489 Over-expression of the OCL1 is associated with colorectal cancer.
23897888 The results suggest that inclusion of IST1 into the ESCRT complex allows recruitment of spastin to promote fission of recycling tubules from the endosome.
23649269 the binding of ALG-2 to IST1 is Ca(2+)-dependent
23609236 OLC1 over-expression is an important factor in epithelial ovarian carcinoma prognosis and can be a potential biomarker for ovarian carcinoma.
21616915 The interaction between CL7MIT and CHMP1B and between CL7MIT and IST1 became stronger when IST1 or CHMP1B was additionally coexpressed, suggesting formation of ternary complex of calpain-7, IST1 and CHMP1B.
21439932 These results demonstrate that cigarette smoke regulates OLC1 expression in lung cancer cells by compromising its ubiquitination and subsequent degradation through the ubiquitin E3 ligase APC.
More...

AA Sequence

MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAME      1 - 70
ILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQ     71 - 140
IGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPG    141 - 210
RGGSGGFTAPVGGPDGTVPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSY    211 - 280
ESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDF    281 - 350
DDLSRRFEELKKKT                                                            351 - 364
//

Text Mined References (51)

PMID Year Title
26040712 2015 Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
26011858 2015 ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
25657007 2015 Distinct mechanisms of recognizing endosomal sorting complex required for transport III (ESCRT-III) protein IST1 by different microtubule interacting and trafficking (MIT) domains.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24953135 2014 Involvement of calpain-7 in epidermal growth factor receptor degradation via the endosomal sorting pathway.
24880589 2014 OLC1 is overexpressed in breast cancer and its expression correlates with poor patient survival.
24608342 2014 Overexpression of OLC1 promotes tumorigenesis of human esophageal squamous cell carcinoma.
24403489 2014 Over-expression of the overexpressed in lung cancer-1 is associated with poor prognosis in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...