Property Summary

NCBI Gene PubMed Count 47
PubMed Score 14.83
PubTator Score 26.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.2e-10
osteosarcoma 7950 3.5e-05
medulloblastoma, large-cell 6241 3.7e-04
glioblastoma 5792 1.2e-03
astrocytoma 1146 2.3e-02
breast carcinoma 1638 2.4e-02
Disease Target Count Z-score Confidence
Paraplegia 74 4.129 2.1
Shigellosis 21 3.015 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.300 2.3e-02
breast carcinoma 1.100 2.4e-02
glioblastoma -1.100 1.2e-03
medulloblastoma, large-cell -1.200 3.7e-04
osteosarcoma -2.517 3.5e-05
ovarian cancer -1.300 9.2e-10

Gene RIF (17)

AA Sequence

MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAME      1 - 70
ILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQ     71 - 140
IGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPG    141 - 210
RGGSGGFTAPVGGPDGTVPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSY    211 - 280
ESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDF    281 - 350
DDLSRRFEELKKKT                                                            351 - 364
//

Text Mined References (53)

PMID Year Title