Property Summary

Ligand Count 65
NCBI Gene PubMed Count 134
PubMed Score 294.18
PubTator Score 285.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 3.591 1.8
Hypoglycemia 152 3.54 1.8
Hyperinsulinism 133 3.395 1.7

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease -1.993 2.5e-02
active ulcerative colitis -1.573 7.5e-03
adrenocortical carcinoma 1.136 2.1e-02
astrocytoma 1.200 3.3e-02
atypical teratoid / rhabdoid tumor 1.300 1.8e-03
Barrett's esophagus 1.300 2.4e-02
Breast cancer 1.300 9.6e-04
colon cancer -1.800 2.5e-02
cutaneous lupus erythematosus 1.500 1.4e-03
dermatomyositis -1.300 9.7e-03
Down syndrome 1.500 3.6e-03
Endometriosis -1.336 3.0e-02
ependymoma 1.600 2.3e-02
esophageal adenocarcinoma 1.900 1.8e-02
glioblastoma 1.500 4.8e-02
group 3 medulloblastoma 1.100 4.5e-02
hereditary spastic paraplegia -1.335 4.6e-03
interstitial cystitis 1.200 3.7e-03
intraductal papillary-mucinous carcinoma... 2.000 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.300 9.1e-03
invasive ductal carcinoma -1.100 4.0e-02
lung cancer 2.600 6.2e-04
medulloblastoma, large-cell 2.000 3.8e-05
nasopharyngeal carcinoma 1.300 8.6e-03
non-small cell lung cancer 1.368 3.3e-11
osteosarcoma 2.950 1.7e-04
ovarian cancer -3.700 1.7e-08
pancreatic cancer 1.200 2.1e-03
pancreatic carcinoma 1.200 2.1e-03
primary pancreatic ductal adenocarcinoma 1.044 1.1e-02
psoriasis 1.600 6.0e-08
X-linked cerebral adrenoleukodystrophy 1.100 4.9e-02

Gene RIF (109)

AA Sequence

MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY      1 - 70
GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY     71 - 140
KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS    141 - 210
KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP    211 - 280
LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS    281 - 350
TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK    351 - 420
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD    421 - 490
GGPKEEESPV                                                                491 - 500
//

Text Mined References (148)

PMID Year Title