Property Summary

NCBI Gene PubMed Count 111
Grant Count 19
R01 Count 9
Funding $1,269,537.47
PubMed Score 263.69
PubTator Score 285.18

Knowledge Summary

Patent

No data available

Expression

Gene RIF (86)

PMID Text
26876179 MCT1 inhibition impairs proliferation of glycolytic breast cancer cells co-expressing MCT1 and MCT4 via disruption of pyruvate rather than lactate export.
26779534 MCT1 expression was not clearly associated with overall or disease-free survival. MCT4 and CD147 expression correlate with worse prognosis across many cancer types. These results warrant further investigation of these associations.
26615136 MCT1 is highly expressed in anaplastic thyroid cancer compared to non-cancerous thyroid tissue and papillary thyroid cancer.
26595136 The most important finding from the present study was that wild-type allele carriers, 2917(1414)T and IVS3-17C, have been associated with higher blood lactate levels at submaximal intensities of exercise for the first time.
26539827 MCT1 and GLUT1 may be potential prognostic markers in adenocarcinoma.
26045776 Down regulation of MCT1 promote the sensitivity to cisplatin in ovarian cancer cells. This effect appeared to be mediated by antagonizing Fas.
26024713 interaction of rmEMMPRINex with U937 cells leads to inhibition of MCT1 membrane expression, intracellular activation of procaspase-9, followed by DNA fragmentation and apoptosis.
25957999 The first IF method has been developed and optimised for detection of MCT 1 and MCT4 in cancer patient circulating tumour cells
25755717 CD147 interacts with MCT1 to regulate tumor cell glycolysis, resulting in the progression of thyroid carcinoma.
25656974 Data suggest that expression of MCT1 in intestinal mucosa can be altered by diet; here, expression of MCT1 is down-regulated in Caco-2 Cells by products of fermentation of dietary proteins by intestinal microbes.
More...

AA Sequence

MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY      1 - 70
GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY     71 - 140
KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS    141 - 210
KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP    211 - 280
LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS    281 - 350
TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK    351 - 420
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD    421 - 490
GGPKEEESPV                                                                491 - 500
//

Text Mined References (125)

PMID Year Title
26876179 2016 MCT1 Modulates Cancer Cell Pyruvate Export and Growth of Tumors that Co-express MCT1 and MCT4.
26779534 2015 Prognostic Indications of Elevated MCT4 and CD147 across Cancer Types: A Meta-Analysis.
26615136 2015 Mitochondrial Metabolism as a Treatment Target in Anaplastic Thyroid Cancer.
26595136 2015 Variants of the Solute Carrier SLC16A1 Gene (MCT1) Associated With Metabolic Responses During a Long-Graded Test in Road Cyclists.
26539827 2015 A Pilot Proteogenomic Study with Data Integration Identifies MCT1 and GLUT1 as Prognostic Markers in Lung Adenocarcinoma.
26045776 2015 MCT1 promotes the cisplatin-resistance by antagonizing Fas in epithelial ovarian cancer.
26024713 2015 Recombinant Multivalent EMMPRIN Extracellular Domain Induces U937 Human Leukemia Cell Apoptosis by Downregulation of Monocarboxylate Transporter 1 and Activation of Procaspase-9.
25957999 2015 Optimisation of immunofluorescence methods to determine MCT1 and MCT4 expression in circulating tumour cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755717 2015 RNA interference targeting CD147 inhibits the proliferation, invasiveness, and metastatic activity of thyroid carcinoma cells by down-regulating glycolysis.
More...