Property Summary

NCBI Gene PubMed Count 111
PubMed Score 263.69
PubTator Score 285.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
glioblastoma multiforme 347 6.54088468275022E-18
non-small cell lung cancer 2798 1.57245659264131E-14
ovarian cancer 8492 1.73391525662657E-8
psoriasis 6685 6.02179807077156E-8
osteosarcoma 7933 3.72665071347677E-6
lung cancer 4473 5.86836513314087E-6
ulcerative colitis 2087 9.50208625355292E-6
medulloblastoma, large-cell 6234 3.78338810407839E-5
pancreatic cancer 2300 6.54571153316871E-4
Breast cancer 3099 9.56086532040253E-4
cutaneous lupus erythematosus 1056 0.00144178708595688
atypical teratoid / rhabdoid tumor 4369 0.00176827287921258
pancreatic carcinoma 567 0.00211498656327895
Down syndrome 548 0.00358455943404717
interstitial cystitis 2299 0.00368540006876781
hereditary spastic paraplegia 313 0.00455747836303857
nasopharyngeal carcinoma 1056 0.00860050867445265
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00907249629056871
dermatomyositis 967 0.00974631482576374
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.01094717642065
primary pancreatic ductal adenocarcinoma 1271 0.0113070249750823
esophageal adenocarcinoma 737 0.0177498559902329
adrenocortical carcinoma 1427 0.021304844169185
ependymoma 2514 0.023346509464752
Barrett's esophagus 185 0.0242925015168779
colon cancer 1475 0.0248024998094131
active Crohn's disease 918 0.025366118651003
Endometriosis 535 0.0300379260253298
astrocytoma 1493 0.0334122805017824
invasive ductal carcinoma 2950 0.0398523196893738
group 3 medulloblastoma 2254 0.0451979013332436
X-linked cerebral adrenoleukodystrophy 115 0.0488823924351511
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0
Disease Target Count Z-score Confidence
Hypoglycemia 81 3.486 1.7
Hyperinsulinism 63 3.418 1.7
Cancer 2346 3.404 1.7

Expression

Synonym

Accession P53985 Q49A45 Q5T8R6 Q9NSJ9 MCT 1
Symbols MCT
HHF7
MCT1
MCT1D

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (86)

PMID Text
26876179 MCT1 inhibition impairs proliferation of glycolytic breast cancer cells co-expressing MCT1 and MCT4 via disruption of pyruvate rather than lactate export.
26779534 MCT1 expression was not clearly associated with overall or disease-free survival. MCT4 and CD147 expression correlate with worse prognosis across many cancer types. These results warrant further investigation of these associations.
26615136 MCT1 is highly expressed in anaplastic thyroid cancer compared to non-cancerous thyroid tissue and papillary thyroid cancer.
26595136 The most important finding from the present study was that wild-type allele carriers, 2917(1414)T and IVS3-17C, have been associated with higher blood lactate levels at submaximal intensities of exercise for the first time.
26539827 MCT1 and GLUT1 may be potential prognostic markers in adenocarcinoma.
26045776 Down regulation of MCT1 promote the sensitivity to cisplatin in ovarian cancer cells. This effect appeared to be mediated by antagonizing Fas.
26024713 interaction of rmEMMPRINex with U937 cells leads to inhibition of MCT1 membrane expression, intracellular activation of procaspase-9, followed by DNA fragmentation and apoptosis.
25957999 The first IF method has been developed and optimised for detection of MCT 1 and MCT4 in cancer patient circulating tumour cells
25755717 CD147 interacts with MCT1 to regulate tumor cell glycolysis, resulting in the progression of thyroid carcinoma.
25656974 Data suggest that expression of MCT1 in intestinal mucosa can be altered by diet; here, expression of MCT1 is down-regulated in Caco-2 Cells by products of fermentation of dietary proteins by intestinal microbes.
More...

AA Sequence

MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY      1 - 70
GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY     71 - 140
KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS    141 - 210
KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP    211 - 280
LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS    281 - 350
TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK    351 - 420
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD    421 - 490
GGPKEEESPV                                                                491 - 500
//

Text Mined References (125)

PMID Year Title
26876179 2016 MCT1 Modulates Cancer Cell Pyruvate Export and Growth of Tumors that Co-express MCT1 and MCT4.
26779534 2015 Prognostic Indications of Elevated MCT4 and CD147 across Cancer Types: A Meta-Analysis.
26615136 2015 Mitochondrial Metabolism as a Treatment Target in Anaplastic Thyroid Cancer.
26595136 2015 Variants of the Solute Carrier SLC16A1 Gene (MCT1) Associated With Metabolic Responses During a Long-Graded Test in Road Cyclists.
26539827 2015 A Pilot Proteogenomic Study with Data Integration Identifies MCT1 and GLUT1 as Prognostic Markers in Lung Adenocarcinoma.
26045776 2015 MCT1 promotes the cisplatin-resistance by antagonizing Fas in epithelial ovarian cancer.
26024713 2015 Recombinant Multivalent EMMPRIN Extracellular Domain Induces U937 Human Leukemia Cell Apoptosis by Downregulation of Monocarboxylate Transporter 1 and Activation of Procaspase-9.
25957999 2015 Optimisation of immunofluorescence methods to determine MCT1 and MCT4 expression in circulating tumour cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755717 2015 RNA interference targeting CD147 inhibits the proliferation, invasiveness, and metastatic activity of thyroid carcinoma cells by down-regulating glycolysis.
More...