Property Summary

NCBI Gene PubMed Count 27
PubMed Score 90.17
PubTator Score 24.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.82725941776869E-22
non-small cell lung cancer 2798 6.49051600491202E-10
medulloblastoma, large-cell 6234 3.88760795227906E-6
atypical teratoid / rhabdoid tumor 4369 3.49823370157241E-5
lung cancer 4473 5.91041474487409E-5
psoriasis 6685 1.00365547978931E-4
ductal carcinoma in situ 1745 3.0381637652718E-4
lung adenocarcinoma 2714 3.88975941796683E-4
Down syndrome 548 7.07920562607655E-4
group 3 medulloblastoma 2254 0.0020620870396089
primitive neuroectodermal tumor 3031 0.00384725639666776
Atopic dermatitis 944 0.00442153679897679
progressive supranuclear palsy 674 0.00660770114768232
invasive ductal carcinoma 2950 0.00682126279000956
ulcerative colitis 2087 0.00796011248191888
ovarian cancer 8492 0.00815429131842613
active Crohn's disease 918 0.00898903036188619
breast carcinoma 1614 0.0120747432581149
Multiple myeloma 1328 0.0130203209169894
adrenocortical carcinoma 1427 0.0163882999201331
fibroadenoma 557 0.0214283748392424
esophageal adenocarcinoma 737 0.0216235546013549
non primary Sjogren syndrome sicca 840 0.02512662122262
adult high grade glioma 2148 0.0383041922097502

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.236 0.013
esophageal adenocarcinoma 1.400 0.022
group 3 medulloblastoma -2.700 0.002
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.200 0.004
Atopic dermatitis -1.300 0.004
adrenocortical carcinoma -1.195 0.016
non-small cell lung cancer -1.679 0.000
lung cancer -1.800 0.000
active Crohn's disease 1.953 0.009
breast carcinoma -1.300 0.012
fibroadenoma -1.700 0.021
adult high grade glioma -1.200 0.038
non primary Sjogren syndrome sicca 1.200 0.025
lung adenocarcinoma -1.100 0.000
psoriasis -1.300 0.000
lung carcinoma -1.200 0.000
progressive supranuclear palsy -1.300 0.007
ductal carcinoma in situ -2.700 0.000
invasive ductal carcinoma -2.400 0.007
ulcerative colitis 1.300 0.008
ovarian cancer 1.200 0.008
Down syndrome 1.300 0.001

Synonym

Accession P53816 B2R7Q4 B7XAK5 Q3SYI3 Q9HDD1 HRSL3
Symbols AdPLA
HRSL3
HRASLS3
HREV107
HREV107-1
HREV107-3
H-REV107-1

Gene

PDB

2KYT   4DOT   4FA0   4Q95  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (14)

PMID Text
26381418 our results revealed that H-rev107 is also involved in lipid accumulation in liver cells through the POR pathway via its PLA2 activity.
26018079 suggest a novel regulatory mechanism for peroxisome biogenesis through the interaction between Pex19p and PLA/AT-3
25993412 Results show that osteosarcoma patients with metastasis showed higher expression of PLA2G16 at both the mRNA and protein levels and shorter overall survival suggesting it as significant prognostic factor for poor outcome.
25871522 the flexible main loop of H-REV107, but not that of TIG3, is critical for its NTD to modulate its CTD in inducing cell death.
25383759 crystal structure of the HRASLS3-LRAT chimeric enzyme in a thioester catalytic intermediate state revealed a major structural rearrangement accompanied by three-dimensional domain swapping dimerization not observed in native HRASLS
25024203 several mutant p53 proteins bind the Pla2g16 promoter at E26 transformation-specific (ETS) binding motifs and knockdown of ETS2 suppressed mutant p53 induction of Pla2g16.
24884338 Our study further suggests that the PLA/AT activity of H-rev107 may play an important role in H-rev107-mediated RAS suppression.
22923616 an alternate mechanism for AdPLA in promoting adipose tissue lipolysis that is not contingent on the release of arachidonic acid and that is compatible with its combined PLA(1)/A(2) activity
22605381 Data show that acyl-modified forms of HRAS-like tumor suppressors HRASLS2 and HRASLS3 mimicking lipolytic activity of lecithin retinol acyltransferase LRAT.
20501645 role of PKC isoenzymes in PP2A and HRSL3(H-REV107-1) tumor suppressor-dependent cell death induction in ovarian carcinoma cell line; verified contribution to PP2A- and HRLS3-dependent apoptosis for PKCzeta suggesting a proapoptotic function of this kinase
More...

AA Sequence

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG      1 - 70
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA     71 - 140
GMGLAAMSLIGVMFSRNKRQKQ                                                    141 - 162
//

Text Mined References (29)

PMID Year Title
26381418 2015 H-rev107 Regulates Cytochrome P450 Reductase Activity and Increases Lipid Accumulation.
26018079 2015 Interaction of Phospholipase A/Acyltransferase-3 with Pex19p: A POSSIBLE INVOLVEMENT IN THE DOWN-REGULATION OF PEROXISOMES.
25993412 2015 PLA2G16 Expression in Human Osteosarcoma Is Associated with Pulmonary Metastasis and Poor Prognosis.
25871522 2015 Structural and functional characterization of tumor suppressors TIG3 and H-REV107.
25416956 2014 A proteome-scale map of the human interactome network.
25383759 2015 LRAT-specific domain facilitates vitamin A metabolism by domain swapping in HRASLS3.
25024203 2014 Pla2g16 phospholipase mediates gain-of-function activities of mutant p53.
24884338 2014 Phospholipase A/Acyltransferase enzyme activity of H-rev107 inhibits the H-RAS signaling pathway.
22923616 2012 Structure/function relationships of adipose phospholipase A2 containing a cys-his-his catalytic triad.
22605381 2012 Structural basis for the acyltransferase activity of lecithin:retinol acyltransferase-like proteins.
More...