Property Summary

NCBI Gene PubMed Count 30
PubMed Score 96.34
PubTator Score 24.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.953 9.0e-03
adrenocortical carcinoma -1.195 1.6e-02
adult high grade glioma -1.200 3.8e-02
Atopic dermatitis -1.300 4.4e-03
atypical teratoid / rhabdoid tumor -1.300 3.5e-05
breast carcinoma -1.300 1.2e-02
Down syndrome 1.300 7.1e-04
ductal carcinoma in situ -2.700 3.0e-04
esophageal adenocarcinoma 1.400 2.2e-02
fibroadenoma -1.700 2.1e-02
group 3 medulloblastoma -2.300 8.0e-04
invasive ductal carcinoma -2.400 6.8e-03
lung adenocarcinoma -1.100 3.9e-04
lung cancer -1.200 1.1e-03
lung carcinoma -1.200 4.8e-22
medulloblastoma, large-cell -2.800 3.9e-06
Multiple myeloma 1.236 1.3e-02
non primary Sjogren syndrome sicca 1.200 2.5e-02
non-small cell lung cancer -1.679 6.5e-10
ovarian cancer 1.200 8.2e-03
primitive neuroectodermal tumor -1.200 3.8e-03
progressive supranuclear palsy -1.300 6.6e-03
psoriasis -1.300 1.0e-04
ulcerative colitis 1.300 8.0e-03

Protein-protein Interaction (2)

Gene RIF (16)

AA Sequence

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG      1 - 70
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA     71 - 140
GMGLAAMSLIGVMFSRNKRQKQ                                                    141 - 162
//

Text Mined References (32)

PMID Year Title