Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $8,627.6
PubMed Score 90.17
PubTator Score 24.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.236 0.013
esophageal adenocarcinoma 1.400 0.022
group 3 medulloblastoma -2.700 0.002
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.200 0.004
Atopic dermatitis -1.300 0.004
adrenocortical carcinoma -1.195 0.016
non-small cell lung cancer -1.679 0.000
lung cancer -1.800 0.000
active Crohn's disease 1.953 0.009
breast carcinoma -1.300 0.012
fibroadenoma -1.700 0.021
adult high grade glioma -1.200 0.038
non primary Sjogren syndrome sicca 1.200 0.025
lung adenocarcinoma -1.100 0.000
psoriasis -1.300 0.000
lung carcinoma -1.200 0.000
progressive supranuclear palsy -1.300 0.007
ductal carcinoma in situ -2.700 0.000
invasive ductal carcinoma -2.400 0.007
ulcerative colitis 1.300 0.008
ovarian cancer 1.200 0.008
Down syndrome 1.300 0.001

Synonym

Accession P53816 B2R7Q4 B7XAK5 Q3SYI3 Q9HDD1 HRSL3
Symbols AdPLA
HRSL3
HRASLS3
HREV107
HREV107-1
HREV107-3
H-REV107-1

Gene

 Grant Application (1)

PDB

2KYT   4DOT   4FA0   4Q95  

Gene RIF (14)

PMID Text
26381418 our results revealed that H-rev107 is also involved in lipid accumulation in liver cells through the POR pathway via its PLA2 activity.
26018079 suggest a novel regulatory mechanism for peroxisome biogenesis through the interaction between Pex19p and PLA/AT-3
25993412 Results show that osteosarcoma patients with metastasis showed higher expression of PLA2G16 at both the mRNA and protein levels and shorter overall survival suggesting it as significant prognostic factor for poor outcome.
25871522 the flexible main loop of H-REV107, but not that of TIG3, is critical for its NTD to modulate its CTD in inducing cell death.
25383759 crystal structure of the HRASLS3-LRAT chimeric enzyme in a thioester catalytic intermediate state revealed a major structural rearrangement accompanied by three-dimensional domain swapping dimerization not observed in native HRASLS
25024203 several mutant p53 proteins bind the Pla2g16 promoter at E26 transformation-specific (ETS) binding motifs and knockdown of ETS2 suppressed mutant p53 induction of Pla2g16.
24884338 Our study further suggests that the PLA/AT activity of H-rev107 may play an important role in H-rev107-mediated RAS suppression.
22923616 an alternate mechanism for AdPLA in promoting adipose tissue lipolysis that is not contingent on the release of arachidonic acid and that is compatible with its combined PLA(1)/A(2) activity
22605381 Data show that acyl-modified forms of HRAS-like tumor suppressors HRASLS2 and HRASLS3 mimicking lipolytic activity of lecithin retinol acyltransferase LRAT.
20501645 role of PKC isoenzymes in PP2A and HRSL3(H-REV107-1) tumor suppressor-dependent cell death induction in ovarian carcinoma cell line; verified contribution to PP2A- and HRLS3-dependent apoptosis for PKCzeta suggesting a proapoptotic function of this kinase
More...

AA Sequence

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG      1 - 70
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA     71 - 140
GMGLAAMSLIGVMFSRNKRQKQ                                                    141 - 162
//

Text Mined References (29)

PMID Year Title
26381418 2015 H-rev107 Regulates Cytochrome P450 Reductase Activity and Increases Lipid Accumulation.
26018079 2015 Interaction of Phospholipase A/Acyltransferase-3 with Pex19p: A POSSIBLE INVOLVEMENT IN THE DOWN-REGULATION OF PEROXISOMES.
25993412 2015 PLA2G16 Expression in Human Osteosarcoma Is Associated with Pulmonary Metastasis and Poor Prognosis.
25871522 2015 Structural and functional characterization of tumor suppressors TIG3 and H-REV107.
25416956 2014 A proteome-scale map of the human interactome network.
25383759 2015 LRAT-specific domain facilitates vitamin A metabolism by domain swapping in HRASLS3.
25024203 2014 Pla2g16 phospholipase mediates gain-of-function activities of mutant p53.
24884338 2014 Phospholipase A/Acyltransferase enzyme activity of H-rev107 inhibits the H-RAS signaling pathway.
22923616 2012 Structure/function relationships of adipose phospholipase A2 containing a cys-his-his catalytic triad.
22605381 2012 Structural basis for the acyltransferase activity of lecithin:retinol acyltransferase-like proteins.
More...