Property Summary

NCBI Gene PubMed Count 32
Grant Count 14
R01 Count 4
Funding $1,200,803.97
PubMed Score 104.48
PubTator Score 83.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
adrenocortical carcinoma -1.021 0.000
colon cancer -1.900 0.000
dermatomyositis -1.100 0.004

Gene RIF (16)

PMID Text
24551305 Caldesmon and smoothelin staining allows better delineation of the muscularis propria from the desmoplastic stromal reaction which provides a critical aide for proper staging of colonic adenocarcinomas.
24409061 During development of advanced liver fibrosis, a subpopulation of myofibroblasts expressing smoothelin may be derived from vascular smooth muscle cells.
24043717 The objective of the following study was to record the specificity and sensitivity of alpha5(IV) loss, smoothelin expression and PLAP expression as markers of gastrointestinal smooth muscle neoplasms
23121329 There is an association between essential hypertension and the SMTN gene.
23060305 lower level of expresseion in colonic inertia patients
23033319 Smoothelin haplotype constructed using rs5997872, rs56095120, rs9621187 and rs10304 was a useful genetic marker of cerebral infarction in Japanese men.
22963604 for the Japanese women, the frequency of the C-T-T-G haplotype (established by rs5997872, rs56095120, rs9621187, and rs10304) was significantly higher in the myocardial infarction group than in the control group
22960022 Phenotypic expression of alpha-smooth muscle actin, smooth muscle myosin heavy chain 2, and smoothelin were significantly decreased in the dissected media, whereas that of osteopontin was elevated.
21683983 Smoothelin immunoreactivity in bladder diverticula confirms limited nature of smoothelin expression in muscularis mucosae and represents useful ancillary technique in proper histopathologic evaluation of diverticular and nondiverticular bladder carcinoma
21472682 We report the first study of smoothelin expression in normal skin
More...

AA Sequence

MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELEREEEALASKRFRAERQDNKENWLHSQQ      1 - 70
REAEQRAALARLAGQLESMNDVEELTALLRSAGEYEERKLIRAAIRRVRAQEIEAATLAGRLYSGRPNSG     71 - 140
SREDSKGLAAHRLEQCEVPEREEQEQQAEVSKPTPTPEGTSQDVTTVTLLLRAPPGSTSSSPASPSSSPT    141 - 210
PASPEPPLEPAEAQCLTAEVPGSPEPPPSPPKTTSPEPQESPTLPSTEGQVVNKLLSGPKETPAAQSPTR    211 - 280
GPSDTKRADVAGPRPCQRSLSVLSPRQPAQNRESTPLASGPSSFQRAGSVRDRVHKFTSDSPMAARLQDG    281 - 350
TPQAALSPLTPARLLGPSLTSTTPASSSSGSSSRGPSDTSSRFSKEQRGVAQPLAQLRSCPQEEGPRGRG    351 - 420
LAARPLENRAGGPVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTL    421 - 490
GLRAPPTLLSTSSGGKSTITRVNSPGTLARLGSVTHVTSFSHAPPSSRGGCSIKMEAEPAEPLAAAVEAA    491 - 560
NGAEQTRVNKAPEGRSPLSAEELMTIEDEGVLDKMLDQSTDFEERKLIRAALRELRQRKRDQRDKERERR    561 - 630
LQEARGRPGEGRGNTATETTTRHSQRAADGSAVSTVTKTERLVHSNDGTRTARTTTVESSFVRRSENGSG    631 - 700
STMMQTKTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEK    701 - 770
LEKEGAAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHN    771 - 840
FFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL    841 - 910
RLRGKNV                                                                   911 - 917
//

Text Mined References (39)

PMID Year Title
24551305 2014 Smoothelin and caldesmon are reliable markers for distinguishing muscularis propria from desmoplasia: a critical distinction for accurate staging colorectal adenocarcinoma.
24409061 2013 Smoothelin, a new marker to determine the origin of liver fibrogenic cells.
24043717 2014 A study of ?5 chain of collagen IV, caldesmon, placental alkaline phosphatase and smoothelin as immunohistochemical markers of gastrointestinal smooth muscle neoplasms.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23121329 2012 Haplotype of smoothelin gene associated with essential hypertension.
23060305 2013 Smoothelin expression in the gastrointestinal tract: implication in colonic inertia.
23033319 2012 Association of the smoothelin (SMTN) gene with cerebral infarction in men: a haplotype-based case-control study.
22963604 2012 A haplotype of the SMTN gene associated with myocardial infarction in Japanese women.
22960022 2012 Association of smooth muscle cell phenotypes with extracellular matrix disorders in thoracic aortic dissection.
More...