Property Summary

NCBI Gene PubMed Count 101
PubMed Score 254.41
PubTator Score 173.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Breast cancer -2.900 1.5e-17
breast carcinoma -1.500 2.0e-25
cystic fibrosis -1.171 1.7e-03
dermatomyositis 1.100 1.2e-02
glioblastoma 2.400 8.3e-03
interstitial cystitis 1.700 6.3e-05
intraductal papillary-mucinous adenoma (... -1.600 3.5e-03
intraductal papillary-mucinous carcinoma... -1.900 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.1e-02
invasive ductal carcinoma -1.135 1.6e-02
juvenile dermatomyositis 1.028 3.3e-06
lung adenocarcinoma -1.100 1.4e-05
lung cancer -3.900 4.1e-05
malignant mesothelioma -1.400 1.8e-06
medulloblastoma -1.100 1.4e-04
medulloblastoma, large-cell -2.400 1.5e-07
non-small cell lung cancer -1.027 2.3e-08
ovarian cancer 1.400 1.8e-08
pancreatic ductal adenocarcinoma liver m... -1.841 5.5e-04
pituitary cancer -1.700 1.0e-05
psoriasis -2.100 1.7e-05
tuberculosis 1.100 1.8e-04

Synonym

Accession P53805 D3DSF9 O00582 O00583 Q53XT0 Q6IBC6 Q7Z555 Q96R03 Q9BU69 Q9UF15 Q9UME4
Symbols CSP1
DSC1
RCN1
DSCR1
MCIP1
ADAPT78

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GWAS Trait (2)

Gene RIF (84)

AA Sequence

MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA      1 - 70
CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF     71 - 140
AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS    141 - 210
VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS                                211 - 252
//

Text Mined References (101)

PMID Year Title