Property Summary

NCBI Gene PubMed Count 94
Grant Count 108
R01 Count 67
Funding $16,326,514.99
PubMed Score 242.01
PubTator Score 173.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P53805 D3DSF9 O00582 O00583 Q53XT0 Q6IBC6 Q7Z555 Q96R03 Q9BU69 Q9UF15 Q9UME4
Symbols CSP1
DSC1
RCN1
DSCR1
MCIP1
ADAPT78

Gene

PANTHER Protein Class (1)

Gene RIF (77)

PMID Text
26569438 The objective of this study was aimed to detect the association of Down syndrome critical region 1 (DSCR1) gene polymorphisms (rs149048873 and rs143081213) and congenital heart disease (CHD) susceptibility.
26497675 Results support overexpression of RCAN1 and particularly the RCAN1.1S isoform during aging as a pathogenic mechanism in both Down syndrome-related and sporadic Alzheimer's disease
26492364 RCAN1 can interact with IkappaBalpha and affect the phosphorylation of IkappaBalpha at tyrosine 42.
26102033 E4BP4 and BIM regulation correlated with that of RCAN1-1. A putative GRE and four EBPREs were identified within 1500bp upstream from the transcription start site of RCAN1-1
25978972 Rcan1-1L may play a protective role in Ang II-treated cardiomyocytes through the induction of mitochondrial autophagy, and may be an alternative method of cardiac protection.
25863471 The sequence variations in RCAN1 promoter are not major genetic factors involved in sporadic CHD, at least in the current research population.
25753203 results suggest the presence of a novel phosphorylation site in RCAN1 and that its phosphorylation influences calcineurin-dependent inflammatory target gene expression
25546086 These results suggest that USP22 positively regulates RCAN1 levels, which would consequently affect diverse RCAN1-linked cellular processes.
25379721 For DSCR1rs6517239, patients with an AA genotype had higher recurrence probability than patients carrying at least one allele G (37 +/- 4% SE vs. 15 +/- 6% SE) (HR: 0.51; 95% CI, 0.27-0.94; P = 0.027).
25377251 Results show that Rcan1 isoform 1L (Rcan1-1L) overexpression specifically activates mitophagy and increases cell survival under hypoxic conditions.
More...

AA Sequence

MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA      1 - 70
CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF     71 - 140
AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS    141 - 210
VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS                                211 - 252
//

Text Mined References (94)

PMID Year Title
26569438 2015 Association Between DSCR1 Variations and Congenital Heart Disease Susceptibility.
26497675 2015 RCAN1 overexpression promotes age-dependent mitochondrial dysregulation related to neurodegeneration in Alzheimer's disease.
26492364 2015 The RCAN1 inhibits NF-?B and suppresses lymphoma growth in mice.
26157140 2015 Pituitary Adenylate Cyclase-activating Polypeptide (PACAP) Targets Down Syndrome Candidate Region 1 (DSCR1/RCAN1) to control Neuronal Differentiation.
26102033 2015 Glucocorticoid-mediated co-regulation of RCAN1-1, E4BP4 and BIM in human leukemia cells susceptible to apoptosis.
25978972 2015 Rcan1-1L overexpression induces mitochondrial autophagy and improves cell survival in angiotensin II-exposed cardiomyocytes.
25863471 2015 Association Between Sequence Variations in RCAN1 Promoter and the Risk of Sporadic Congenital Heart Disease in a Chinese Population.
25753203 2015 PKA regulates calcineurin function through the phosphorylation of RCAN1: identification of a novel phosphorylation site.
25546086 2015 Ubiquitin-specific protease 22 (USP22) positively regulates RCAN1 protein levels through RCAN1 de-ubiquitination.
25379721 2015 Genetic variants within obesity-related genes are associated with tumor recurrence in patients with stages II/III colon cancer.
More...