Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.25
PubTator Score 13.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
lung carcinoma 2844 1.51039939169678E-28
osteosarcoma 7933 9.79284620836701E-7
ovarian cancer 8492 5.14133200044513E-6
group 4 medulloblastoma 1875 1.60526854574231E-5
Pick disease 1893 1.71707097110546E-5
medulloblastoma, large-cell 6234 5.58975844870029E-4
atypical teratoid / rhabdoid tumor 4369 0.00209357603729063
lung adenocarcinoma 2714 0.0021590031480027
psoriasis 6685 0.00298534292035814
permanent atrial fibrillation 44 0.00816943910556167
Gaucher disease type 1 171 0.00882671131359319
cutaneous lupus erythematosus 1056 0.0135933147145994
Waldenstrons macroglobulinemia 765 0.0137670119628801
Becker muscular dystrophy 187 0.0162583428024223
progressive supranuclear palsy 674 0.0184564053731581
oligodendroglioma 2849 0.0195839614979751
Rheumatoid Arthritis 1171 0.0209010934012985
non primary Sjogren syndrome sicca 840 0.0247161981587607
acute myeloid leukemia 785 0.0329847646435256
intraductal papillary-mucinous adenoma (IPMA) 2956 0.034877006410834
Alzheimer's disease 644 0.0364799758518104
Parkinson's disease 364 0.0413492926306765
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Syphilis 18 3.871 1.9

Expression

Synonym

Accession P53804 A8K7H7 B2RPA7 D3DSG9 D3DSH2 D3DSH3 O60767 P78476 P78477 Q569I2 Q6P578 Q9UEK4
Symbols DCRR1
RNF105
TPRDIII

Gene

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20059950 Interaction between TTC3 and Akt may contribute to the clinical symptoms of Down syndrome.
18854154 Knockdown of tetratricopeptide repeat domain 3 (TTC3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17488780 These results suggest that the TTC3-RhoA-CIT-K pathway could be a crucial determinant of in vivo neuronal development, whose hyperactivity may result in detrimental effects on the normal differentiation program.

AA Sequence

MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIW      1 - 70
CSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCVDANNSRASEINLKKLQHLELMEDIVDLAKK     71 - 140
VANDSFLIGGLLRIGCKIENKILAMEEALNWIKYAGDVTILTKLGSIDNCWPMLSIFFTEYKYHITKIVM    141 - 210
EDCNLLEELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRALCFLRTGQ    211 - 280
FRNALGDGKRATILKNTWPKGHYRYCDALSMLGEYDWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQI    281 - 350
EDLQGRTANKDPIKAFYENRAYTPRSLSAPIFTTSLNFVEKERDFRKINHEMANGGNQNLKVADEALKVD    351 - 420
DCDCHPEFSPPSSQPPKHKGKQKSRNNESEKFSSSSPLTLPADLKNILEKQFSKSSRAAHQDFANIMKML    421 - 490
RSLIQDGYMALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLVVYGLAISLLGIGQPEELSEAEN    491 - 560
QFKRIIEHYPSEGLDCLAYCGIGKVYLKKNRFLEALNHFEKARTLIYRLPGVLTWPTSNVIIEESQPQKI    561 - 630
KMLLEKFVEECKFPPVPDAICCYQKCHGYSKIQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTF    631 - 700
NDKIDKDFLQGICLTPDCEGVISKIIIFSSGGEVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKK    701 - 770
LKRKIQKKEAKKLAQERMEEDLRESNPPKNEEQKETVDNVQRCQFLDDRILQCIKQYADKIKSGIQNTAM    771 - 840
LLKELLSWKVLSTEDYTTCFSSRNFLNEAVDYVIRHLIQENNRVKTRIFLHVLSELKEVEPKLAAWIQKL    841 - 910
NSFGLDATGTFFSRYGASLKLLDFSIMTFLWNEKYGHKLDSIEGKQLDYFSEPASLKEARCLIWLLEEHR    911 - 980
DKFPALHSALDEFFDIMDSRCTVLRKQDSGEAPFSSTKVKNKSKKKKPKDSKPMLVGSGTTSVTSNNEII    981 - 1050
TSSEDHSNRNSDSAGPFAVPDHLRQDVEEFEALYDQHSNEYVVRNKKLWDMNPKQKCSTLYDYFSQFLEE   1051 - 1120
HGPLDMSNKMFSAEYEFFPEETRQILEKAGGLKPFLLGCPRFVVIDNCIALKKVASRLKKKRKKKNIKTK   1121 - 1190
VEEISKAGEYVRVKLQLNPAAREFKPDVKSKPVSDSSSAPAFENVKPKPVSANSPKPACEDVKAKPVSDN   1191 - 1260
SSRQVSEDGQPKGVSSNSPKPGSEDANYKRVSCNSPKPVLEDVKPTYWAQSHLVTGYCTYLPFQRFDITQ   1261 - 1330
TPPAYINVLPGLPQYTSIYTPLASLSPEYQLPRSVPVVPSFVANDRADKNAAAYFEGHHLNAENVAGHQI   1331 - 1400
ASETQILEGSLGISVKSHCSTGDAHTVLSESNRNDEHCGNSNNKCEVIPESTSAVTNIPHVQMVAIQVSW   1401 - 1470
NIIHQEVNTEPYNPFEERQGEISRIEKEHQVLQDQLQEVYENYEQIKLKGLEETRDLEEKLKRHLEENKI   1471 - 1540
SKTELDWFLQDLEREIKKWQQEKKEIQERLKSLKKKIKKVSNASEMYTQKNDGKEKEHELHLDQSLEISN   1541 - 1610
TLTNEKMKIEEYIKKGKEDYEESHQRAVAAEVSVLENWKESEVYKLQIMESQAEAFLKKLGLISRDPAAY   1611 - 1680
PDMESDIRSWELFLSNVTKEIEKAKSQFEEQIKAIKNGSRLSELSKVQISELSFPACNTVHPELLPESSG   1681 - 1750
DDGQGLVTSASDVTGNHAALHRDPSVFSAGDSPGEAPSALLPGPPPGQPEATQLTGPKRAGQAALSERSP   1751 - 1820
VADRKQPVPPGRAARSSQSPKKPFNSIIEHLSVVFPCYNSTELAGFIKKVRSKNKNSLSGLSIDEIVQRV   1821 - 1890
TEHILDEQKKKKPNPGKDKRTYEPSSATPVTRSSQGSPSVVVAPSPKTKGQKAEDVPVRIALGASSCEIC   1891 - 1960
HEVFKSKNVRVLKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCSSR        1961 - 2025
//

Text Mined References (17)

PMID Year Title
20463881 2010 Digital quantification of human eye color highlights genetic association of three new loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20059950 2009 The E3 ligase TTC3 facilitates ubiquitination and degradation of phosphorylated Akt.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17488780 2007 The Down syndrome critical region protein TTC3 inhibits neuronal differentiation via RhoA and Citron kinase.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...