Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.45
PubTator Score 13.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Down syndrome 1.400 1.3e-02
acute myeloid leukemia 1.300 3.3e-02
Alzheimer's disease -1.300 3.6e-02
atypical teratoid / rhabdoid tumor 1.300 2.1e-03
Becker muscular dystrophy -1.017 1.6e-02
cutaneous lupus erythematosus -1.100 1.4e-02
Gaucher disease type 1 -1.400 8.8e-03
group 3 medulloblastoma 1.400 2.5e-02
intraductal papillary-mucinous adenoma (... 1.400 2.2e-02
lung adenocarcinoma 1.394 2.2e-03
lung carcinoma 1.200 1.5e-28
medulloblastoma, large-cell 1.700 5.6e-04
non primary Sjogren syndrome sicca -1.300 2.5e-02
oligodendroglioma 1.100 2.0e-02
osteosarcoma 4.260 9.8e-07
ovarian cancer -2.200 3.5e-10
Parkinson's disease -1.600 4.1e-02
permanent atrial fibrillation -1.300 8.2e-03
Pick disease -1.500 1.7e-05
progressive supranuclear palsy -1.100 1.2e-02
psoriasis -1.200 3.0e-03
Rheumatoid arthritis 1.700 2.1e-02
Waldenstrons macroglobulinemia 1.118 1.4e-02

Gene RIF (4)

AA Sequence

MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIW      1 - 70
CSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCVDANNSRASEINLKKLQHLELMEDIVDLAKK     71 - 140
VANDSFLIGGLLRIGCKIENKILAMEEALNWIKYAGDVTILTKLGSIDNCWPMLSIFFTEYKYHITKIVM    141 - 210
EDCNLLEELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRALCFLRTGQ    211 - 280
FRNALGDGKRATILKNTWPKGHYRYCDALSMLGEYDWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQI    281 - 350
EDLQGRTANKDPIKAFYENRAYTPRSLSAPIFTTSLNFVEKERDFRKINHEMANGGNQNLKVADEALKVD    351 - 420
DCDCHPEFSPPSSQPPKHKGKQKSRNNESEKFSSSSPLTLPADLKNILEKQFSKSSRAAHQDFANIMKML    421 - 490
RSLIQDGYMALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLVVYGLAISLLGIGQPEELSEAEN    491 - 560
QFKRIIEHYPSEGLDCLAYCGIGKVYLKKNRFLEALNHFEKARTLIYRLPGVLTWPTSNVIIEESQPQKI    561 - 630
KMLLEKFVEECKFPPVPDAICCYQKCHGYSKIQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTF    631 - 700
NDKIDKDFLQGICLTPDCEGVISKIIIFSSGGEVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKK    701 - 770
LKRKIQKKEAKKLAQERMEEDLRESNPPKNEEQKETVDNVQRCQFLDDRILQCIKQYADKIKSGIQNTAM    771 - 840
LLKELLSWKVLSTEDYTTCFSSRNFLNEAVDYVIRHLIQENNRVKTRIFLHVLSELKEVEPKLAAWIQKL    841 - 910
NSFGLDATGTFFSRYGASLKLLDFSIMTFLWNEKYGHKLDSIEGKQLDYFSEPASLKEARCLIWLLEEHR    911 - 980
DKFPALHSALDEFFDIMDSRCTVLRKQDSGEAPFSSTKVKNKSKKKKPKDSKPMLVGSGTTSVTSNNEII    981 - 1050
TSSEDHSNRNSDSAGPFAVPDHLRQDVEEFEALYDQHSNEYVVRNKKLWDMNPKQKCSTLYDYFSQFLEE   1051 - 1120
HGPLDMSNKMFSAEYEFFPEETRQILEKAGGLKPFLLGCPRFVVIDNCIALKKVASRLKKKRKKKNIKTK   1121 - 1190
VEEISKAGEYVRVKLQLNPAAREFKPDVKSKPVSDSSSAPAFENVKPKPVSANSPKPACEDVKAKPVSDN   1191 - 1260
SSRQVSEDGQPKGVSSNSPKPGSEDANYKRVSCNSPKPVLEDVKPTYWAQSHLVTGYCTYLPFQRFDITQ   1261 - 1330
TPPAYINVLPGLPQYTSIYTPLASLSPEYQLPRSVPVVPSFVANDRADKNAAAYFEGHHLNAENVAGHQI   1331 - 1400
ASETQILEGSLGISVKSHCSTGDAHTVLSESNRNDEHCGNSNNKCEVIPESTSAVTNIPHVQMVAIQVSW   1401 - 1470
NIIHQEVNTEPYNPFEERQGEISRIEKEHQVLQDQLQEVYENYEQIKLKGLEETRDLEEKLKRHLEENKI   1471 - 1540
SKTELDWFLQDLEREIKKWQQEKKEIQERLKSLKKKIKKVSNASEMYTQKNDGKEKEHELHLDQSLEISN   1541 - 1610
TLTNEKMKIEEYIKKGKEDYEESHQRAVAAEVSVLENWKESEVYKLQIMESQAEAFLKKLGLISRDPAAY   1611 - 1680
PDMESDIRSWELFLSNVTKEIEKAKSQFEEQIKAIKNGSRLSELSKVQISELSFPACNTVHPELLPESSG   1681 - 1750
DDGQGLVTSASDVTGNHAALHRDPSVFSAGDSPGEAPSALLPGPPPGQPEATQLTGPKRAGQAALSERSP   1751 - 1820
VADRKQPVPPGRAARSSQSPKKPFNSIIEHLSVVFPCYNSTELAGFIKKVRSKNKNSLSGLSIDEIVQRV   1821 - 1890
TEHILDEQKKKKPNPGKDKRTYEPSSATPVTRSSQGSPSVVVAPSPKTKGQKAEDVPVRIALGASSCEIC   1891 - 1960
HEVFKSKNVRVLKCGHKYHKGCFKQWLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCSSR        1961 - 2025
//

Text Mined References (17)

PMID Year Title