Property Summary

NCBI Gene PubMed Count 81
PubMed Score 7.36
PubTator Score 3.27

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma -1.300 2.0e-02
Breast cancer 1.100 4.9e-08
breast carcinoma 1.100 1.7e-22
invasive ductal carcinoma 1.400 2.8e-02
lung cancer 1.100 9.8e-04
Multiple myeloma 1.057 4.5e-03
ovarian cancer 1.100 3.8e-02

Gene RIF (80)

AA Sequence

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR                  1 - 58
//

Text Mined References (81)

PMID Year Title