Property Summary

NCBI Gene PubMed Count 20
PubMed Score 40.41
PubTator Score 81.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
acute myeloid leukemia -1.200 3.6e-02
acute quadriplegic myopathy 1.477 4.3e-06
Alzheimer's disease 1.300 3.0e-02
astrocytic glioma 1.100 3.8e-03
atypical teratoid / rhabdoid tumor 1.300 8.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.338 7.4e-03
Breast cancer 3.200 2.4e-02
ependymoma 1.600 2.9e-02
gastric cancer 1.100 1.6e-03
glioblastoma 1.200 1.7e-02
intraductal papillary-mucinous adenoma (... 1.100 2.2e-03
intraductal papillary-mucinous carcinoma... 1.400 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.2e-02
invasive ductal carcinoma 1.052 4.3e-02
juvenile dermatomyositis 1.325 4.5e-11
lung adenocarcinoma 1.200 3.4e-04
lung cancer 1.900 6.2e-04
malignant mesothelioma 1.300 3.2e-05
medulloblastoma, large-cell 1.600 2.4e-04
non-small cell lung cancer 1.190 5.7e-11
osteosarcoma -2.855 2.5e-06
pancreatic cancer 1.100 3.3e-05
Pick disease 1.700 1.5e-04
progressive supranuclear palsy 1.700 3.4e-02
psoriasis 1.400 3.0e-03
sarcoidosis 1.300 2.6e-02
subependymal giant cell astrocytoma 1.391 3.5e-02
tuberculosis -1.300 1.2e-03
ulcerative colitis -1.217 1.9e-02

Gene RIF (10)

AA Sequence

MRAVLDTADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVTIGASLFVSNIGSEHFIGLAG      1 - 70
SGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLS     71 - 140
VDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGF    141 - 210
EEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQ    211 - 280
VIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIA    281 - 350
YPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVV    351 - 420
ISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFA    421 - 490
YRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKNLVVKENCSP    491 - 560
KEEPYQMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDA    561 - 630
YSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVKVILNI    631 - 700
GLFAVCSLGIFMFVYFSL                                                        701 - 718
//

Text Mined References (21)

PMID Year Title