Property Summary

NCBI Gene PubMed Count 18
PubMed Score 34.74
PubTator Score 81.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.54400430719833E-11
non-small cell lung cancer 2798 5.68692880264657E-11
osteosarcoma 7933 2.50528540573185E-6
acute quadriplegic myopathy 1157 4.25973487247615E-6
pancreatic cancer 2300 3.32967946086083E-5
tuberculosis 1563 6.53877131626311E-5
malignant mesothelioma 3163 6.66246430350008E-5
atypical teratoid / rhabdoid tumor 4369 1.21653855752584E-4
Pick disease 1893 1.52022676208965E-4
medulloblastoma, large-cell 6234 2.43893874967251E-4
lung adenocarcinoma 2714 4.83583318168131E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00113366055251822
gastric cancer 436 0.00162622662094228
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00182562615326758
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00219337100232008
lung cancer 4473 0.0028110359675712
psoriasis 6685 0.00299229615381322
astrocytic glioma 2241 0.00380443303187436
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00737832391481364
subependymal giant cell astrocytoma 2287 0.0133274931224913
glioblastoma 5572 0.0172726495067304
ulcerative colitis 2087 0.0192256437951998
Breast cancer 3099 0.0238523710285762
sarcoidosis 368 0.0256747401667249
ependymoma 2514 0.0286299664018621
Alzheimer's disease 644 0.0298294370885115
progressive supranuclear palsy 674 0.0335318506920313
acute myeloid leukemia 785 0.0362178823702109
invasive ductal carcinoma 2950 0.0431841197370365

Expression

Synonym

Accession P53794 O43489 Na(+)/myo-inositol cotransporter
Symbols BCW2
SMIT
SMIT1
SMIT2

Gene

PANTHER Protein Class (2)

  Ortholog (3)

Species Source
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25756525 Hypotonic stress causes a significant upregulation of SLC5A3 gene expression as detected by semiquantitative RT-PCR and Western blot analysis.
24944204 A kinetic model has been generated for the transport mechanism of SMIT2 allowing insight into the transport of members of the LeuT structural family at the millisecond timescale.
23207989 JAK2 contributes to the regulation of the myoinositol transporter SMIT.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19032932 Expression and/or function of SMIT2 may be reduced in diabetes mellitus, insulin resistance and polycystic ovary syndrome causing abnormal inositol meteabolism
17178845 Tumor cells silence SLC5A8 and convert pyruvate into lactate as complementary mechanisms to avoid pyruvate-induced cell death.

AA Sequence

MRAVLDTADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVTIGASLFVSNIGSEHFIGLAG      1 - 70
SGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLS     71 - 140
VDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGF    141 - 210
EEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQ    211 - 280
VIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIA    281 - 350
YPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVV    351 - 420
ISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFA    421 - 490
YRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKNLVVKENCSP    491 - 560
KEEPYQMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDA    561 - 630
YSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVKVILNI    631 - 700
GLFAVCSLGIFMFVYFSL                                                        701 - 718
//

Text Mined References (19)

PMID Year Title
25756525 2015 Hypotonic activation of the myo-inositol transporter SLC5A3 in HEK293 cells probed by cell volumetry, confocal and super-resolution microscopy.
24944204 2014 The transport mechanism of the human sodium/myo-inositol transporter 2 (SMIT2/SGLT6), a member of the LeuT structural family.
23207989 2012 Down-regulation of the myoinositol transporter SMIT by JAK2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
19032932 2009 Human sodium/inositol cotransporter 2 (SMIT2) transports inositols but not glucose in L6 cells.
17178845 2006 SLC5A8 triggers tumor cell apoptosis through pyruvate-dependent inhibition of histone deacetylases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...