Property Summary

NCBI Gene PubMed Count 18
Grant Count 10
R01 Count 6
Funding $1,706,985.25
PubMed Score 34.74
PubTator Score 81.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25756525 Hypotonic stress causes a significant upregulation of SLC5A3 gene expression as detected by semiquantitative RT-PCR and Western blot analysis.
24944204 A kinetic model has been generated for the transport mechanism of SMIT2 allowing insight into the transport of members of the LeuT structural family at the millisecond timescale.
23207989 JAK2 contributes to the regulation of the myoinositol transporter SMIT.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19032932 Expression and/or function of SMIT2 may be reduced in diabetes mellitus, insulin resistance and polycystic ovary syndrome causing abnormal inositol meteabolism
17178845 Tumor cells silence SLC5A8 and convert pyruvate into lactate as complementary mechanisms to avoid pyruvate-induced cell death.

AA Sequence

MRAVLDTADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVTIGASLFVSNIGSEHFIGLAG      1 - 70
SGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLS     71 - 140
VDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGF    141 - 210
EEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQ    211 - 280
VIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIA    281 - 350
YPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVV    351 - 420
ISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFA    421 - 490
YRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKNLVVKENCSP    491 - 560
KEEPYQMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDA    561 - 630
YSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVKVILNI    631 - 700
GLFAVCSLGIFMFVYFSL                                                        701 - 718
//

Text Mined References (19)

PMID Year Title
25756525 2015 Hypotonic activation of the myo-inositol transporter SLC5A3 in HEK293 cells probed by cell volumetry, confocal and super-resolution microscopy.
24944204 2014 The transport mechanism of the human sodium/myo-inositol transporter 2 (SMIT2/SGLT6), a member of the LeuT structural family.
23207989 2012 Down-regulation of the myoinositol transporter SMIT by JAK2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
19032932 2009 Human sodium/inositol cotransporter 2 (SMIT2) transports inositols but not glucose in L6 cells.
17178845 2006 SLC5A8 triggers tumor cell apoptosis through pyruvate-dependent inhibition of histone deacetylases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...