Property Summary

Ligand Count 152
NCBI Gene PubMed Count 71
PubMed Score 193.28
PubTator Score 84.39

Knowledge Summary

Patent (30,830)

TINX Plot

  Disease (5)

Expression

Protein-protein Interaction (3)

Gene RIF (36)

AA Sequence

MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPI      1 - 70
GSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQ     71 - 140
DVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL    141 - 210
ARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLG    211 - 280
TPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISV    281 - 350
DDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA    351 - 420
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR                              421 - 464
//

Text Mined References (75)

PMID Year Title