Property Summary

NCBI Gene PubMed Count 68
Grant Count 116
R01 Count 93
Funding $12,231,207.16
PubMed Score 181.64
PubTator Score 84.39

Knowledge Summary

Patent (30,830)

Expression

Synonym

Accession P53779 A6NFS3 A6NG28 B3KQ94 Q15707 Q49AP1 MAP kinase 10
Symbols JNK3
JNK3A
PRKM10
SAPK1b
p493F12
p54bSAPK

Gene

PDB

4H36   1JNK   1PMN   1PMU   1PMV   2B1P   2EXC   2O0U   2O2U   2OK1   2P33   2R9S   2WAJ   2ZDT   2ZDU   3CGF   3CGO   3DA6   3FI2   3FI3   3FV8   3G90   3G9L   3G9N   3KVX   3OXI   3OY1   3PTG   3RTP   3TTI   3TTJ   3V6R   3V6S   4H39   4H3B   4KKE   4KKG   4KKH   4U79   4W4V   4W4W   4W4X   4W4Y   4WHZ   4X21   4Y46   4Y5H   4Z9L  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
746 screening 366 / 0 / 59439 Primary biochemical high-throughput screening assay for inhibitors of the c-Jun N-Terminal Kinase 3 (JNK3)
1284 confirmatory 57 / 0 / 305 Dose response biochemical screening assay for inhibitors of c-Jun N-Terminal Kinase 3 (JNK3)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (34)

PMID Text
25475894 Data indicate that tetra-substituted pyridinylimidazoles were designed as dual inhibitors of c-Jun N-terminal kinase (JNK) 3 and p38alpha mitogen-activated protein (MAP) kinase, and both kinases may be involved in the progression of Huntington's disease.
25455349 Study found that JNK3 levels are increased in brain tissue and CSF from patients with Alzheimer disease and CSF levels could reflect the rate of cognitive decline
25178256 analysis of the unique mechanisms by which JNK1beta1 is regulated
25025079 JNK3 is required for the antiapoptotic effects of exendin 4
24767251 miR-29b mRNA, MAPK10 protein expression, and ATG9A protein expression are closely related to chemosensitivity of ovarian carcinoma.
24412749 Mitogen-activated protein kinase 10 JNK3 alpha (JNK3apha2)binds to both domains of arrestin-3.
23329067 reduced JNK3 activity has potentially deleterious effects on neuronal function via altered regulation of a set of post-synaptic proteins.
23142346 Subtle structural mechanisms for allosteric signaling between the peptide-binding site and activation loop of human JNK3.
22523077 Silent scaffolds: inhibition OF c-Jun N-terminal kinase 3 activity in cell by dominant-negative arrestin-3 mutant.
22047447 Arrestin-3 acts as a "true" scaffold, facilitating JNK3alpha2 phosphorylation by bringing it and MAP kinase kinase (MKK)4 together.
More...

AA Sequence

MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPI      1 - 70
GSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQ     71 - 140
DVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL    141 - 210
ARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLG    211 - 280
TPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISV    281 - 350
DDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA    351 - 420
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR                              421 - 464
//

Text Mined References (72)

PMID Year Title
25475894 2015 Tetra-substituted pyridinylimidazoles as dual inhibitors of p38? mitogen-activated protein kinase and c-Jun N-terminal kinase 3 for potential treatment of neurodegenerative diseases.
25455349 2015 Increased levels of cerebrospinal fluid JNK3 associated with amyloid pathology: links to cognitive decline.
25353672 2015 Genome wide association study identifies a novel putative mammographic density locus at 1q12-q21.
25178256 2014 Phosphorylation- and nucleotide-binding-induced changes to the stability and hydrogen exchange patterns of JNK1?1 provide insight into its mechanisms of activation.
25025079 2014 JNK3 is required for the cytoprotective effect of exendin 4.
25013167 2014 Evidence of efficient stop codon readthrough in four mammalian genes.
25009551 2014 The ATXN2-SH2B3 locus is associated with peripheral arterial disease: an electronic medical record-based genome-wide association study.
24767251 2014 Involvement of miR-29b signaling in the sensitivity to chemotherapy in patients with ovarian carcinoma.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24412749 2014 Arrestin-3 binds the MAP kinase JNK3?2 via multiple sites on both domains.
More...