Property Summary

NCBI Gene PubMed Count 60
Grant Count 25
R01 Count 10
Funding $17,747,882.07
PubMed Score 83.17
PubTator Score 43.27

Knowledge Summary

Patent (12,035)

Expression

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (31)

PMID Text
26843485 p38gamma and p38delta reprogram liver metabolism by modulating neutrophil infiltration and provide a potential target for NAFLD therapy
26708186 during interphase ERK3 is mainly resident in the nucleoplasm in association with ribonuclear proteins involved in early pre-mRNA splicing, it undergoes cell cycle-dependent redistribution and, during apoptosis
26588708 Taken together our data suggest that as cells initiate adhesion to matrix increasing levels of ERK3 at the cell periphery are required to orchestrate cell morphology changes which can then drive migratory behavior.
26418945 This study reveals a novel pathway that directly links ErbB4 and p38gamma to the transcriptional machinery of NKx2.5-GATA4 complex which is critical for cardiomyocyte formation during mammalian heart development.
25314968 analysis of how allosteric regulation of p38gamma and PTPN3 involves a PDZ domain-modulated complex formation
22730327 SEPW1 silencing increases MKK4, which activates p38gamma, p38delta, and JNK2 to phosphorylate p53 on Ser-33 and cause a transient G(1) arrest.
22730326 p38gamma Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.
22522454 Thus, in endothelial cells p38alpha mediates apoptotic signaling, whereas p38beta and p38gamma transduce survival signaling
22399296 phosphorylation at Ser-118 is required for ER to bind both p38gamma and c-Jun, thereby promoting ER relocation from ERE to AP-1 promoter sites.
21878638 a new paradigm in which p38gamma actively regulates the drug-Topo IIalpha signal transduction, and this may be exploited to increase the therapeutic activity of Topo II drugs.
More...

AA Sequence

MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKR      1 - 70
AYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKG     71 - 140
LRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIW    141 - 210
SVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA    211 - 280
SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLS    281 - 350
FKPPRQLGARVSKETPL                                                         351 - 367
//

Text Mined References (66)

PMID Year Title
26843485 2016 p38? and p38? reprogram liver metabolism by modulating neutrophil infiltration.
26708186 2015 Analysis of ERK3 intracellular localization: dynamic distribution during mitosis and apoptosis.
26588708 2015 A novel role for atypical MAPK kinase ERK3 in regulating breast cancer cell morphology and migration.
26418945 2016 ErbB4 Activated p38? MAPK Isoform Mediates Early Cardiogenesis Through NKx2.5 in Human Pluripotent Stem Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25314968 2014 Reciprocal allosteric regulation of p38? and PTPN3 involves a PDZ domain-modulated complex formation.
25158884 2014 Regulation of the catalytic activity of the human phosphatase PTPN4 by its PDZ domain.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22730327 2012 Delayed cell cycle progression in selenoprotein W-depleted cells is regulated by a mitogen-activated protein kinase kinase 4-p38/c-Jun NH2-terminal kinase-p53 pathway.
More...