Property Summary

NCBI Gene PubMed Count 24
PubMed Score 2284.31
PubTator Score 343.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
MICROPHTHALMIA, SYNDROMIC 7 3 0.0 0.0
Disease Target Count Z-score Confidence
Microphthalmia 76 5.398 2.7

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.000 8.9e-03
atypical teratoid / rhabdoid tumor -1.400 3.6e-05
ependymoma -1.700 3.2e-02
glioblastoma -1.100 6.1e-05
intraductal papillary-mucinous neoplasm ... 2.100 3.5e-03
lung cancer -1.100 1.1e-02
medulloblastoma -1.200 3.4e-04
medulloblastoma, large-cell -1.700 3.5e-05
Multiple myeloma 1.015 6.3e-03
ovarian cancer 1.200 1.9e-03
psoriasis 1.800 4.6e-05
tuberculosis -1.400 2.5e-05

Protein-protein Interaction (12)

Gene RIF (9)

AA Sequence

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG      1 - 70
TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE     71 - 140
DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR    141 - 210
HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS                211 - 268
//

Text Mined References (25)

PMID Year Title