Property Summary

NCBI Gene PubMed Count 25
PubMed Score 25.52
PubTator Score 18.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 2.000 7.2e-06
psoriasis 1.600 4.6e-05

Gene RIF (17)

AA Sequence

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC      1 - 70
VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS     71 - 140
LE                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title