Property Summary

NCBI Gene PubMed Count 25
Grant Count 9
R01 Count 8
Funding $1,896,447.5
PubMed Score 21.40
PubTator Score 17.09

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -2.203 0.000
diabetes mellitus -1.100 0.010
pituitary cancer -1.100 0.000

Gene RIF (8)

26068709 CLTCL1 is significantly upregulated in the developing human brain
25496667 Genome-wide shRNA screening identifies CLTCL1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22891263 Depletion of clathrin heavy chain (CHC)17, but not the CHC22 clathrin isoform, by ribonucleic acid interference (RNAi) induces centrosome amplification and multipolar spindles.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20065094 CHC22 was required for retrograde trafficking of certain cargo molecules from endosomes to the trans-Golgi network.
19478182 role for CHC22 in formation of insulin-responsive GLUT4 compartments in muscle & adipocytes; CHC22 associated with expanded GLUT4 compartments in muscle in type 2 diabetes
15133132 Clathrin isoform CHC22 binds to sorting nexin 5 through a coiled-coil domain.

AA Sequence

DKLDALESLRKQEEHVTEPAPLVFDFDGHE                                           1611 - 1640

Publication (26)

PMID Year Title
26068709 2015 A novel disorder reveals clathrin heavy chain-22 is essential for human pain and touch development.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22891263 2012 Clathrin promotes centrosome integrity in early mitosis through stabilization of centrosomal ch-TOG.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20065094 2010 The clathrin heavy chain isoform CHC22 functions in a novel endosomal sorting step.
19946888 2010 Defining the membrane proteome of NK cells.
19509056 2009 Functional equivalence of the clathrin heavy chains CHC17 and CHC22 in endocytosis and mitosis.