Property Summary

NCBI Gene PubMed Count 43
PubMed Score 77.21
PubTator Score 51.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

AA Sequence

MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQ      1 - 70
GRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFR     71 - 140
PIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEP    141 - 210
GDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK                                211 - 252
//

Text Mined References (44)

PMID Year Title