Property Summary

NCBI Gene PubMed Count 21
PubMed Score 15.49
PubTator Score 15.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILE      1 - 70
RGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVG     71 - 140
SFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQ                  141 - 196
//

Text Mined References (20)

PMID Year Title