Property Summary

Ligand Count 100
NCBI Gene PubMed Count 51
PubMed Score 41.32
PubTator Score 40.05

Knowledge Summary

Patent (7,267)

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 7.7e-04
axial spondyloarthropathy 1.100 4.1e-02
ependymoma 1.300 1.3e-04
glioblastoma multiforme 1.100 1.1e-10
intraductal papillary-mucinous adenoma (... 2.700 6.8e-04
intraductal papillary-mucinous carcinoma... 2.100 5.2e-03
lung cancer -1.500 9.1e-03
malignant mesothelioma -1.200 3.0e-06
osteosarcoma -1.717 6.2e-06
ovarian cancer 3.300 1.4e-07
psoriasis 2.100 1.0e-04
subependymal giant cell astrocytoma 1.731 2.1e-02

Protein-protein Interaction (3)

Gene RIF (31)

AA Sequence

MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGE      1 - 70
FCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTE     71 - 140
SVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGT    141 - 210
PVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLR    211 - 280
RRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTH    281 - 350
KATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM    351 - 420
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATT    421 - 490
KKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNV    491 - 560
KLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEELDHTVSMQY    561 - 630
GLTRDSPP                                                                  631 - 638
//

Text Mined References (58)

PMID Year Title