Property Summary

NCBI Gene PubMed Count 101
Grant Count 138
R01 Count 99
Funding $8,928,590.61
PubMed Score 175.37
PubTator Score 148.63

Knowledge Summary

Patent (6,149)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -3.800 0.000
osteosarcoma -2.042 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
adult high grade glioma -1.300 0.001
posterior fossa group B ependymoma -1.100 0.000
lung adenocarcinoma 1.900 0.000
COPD -1.200 0.011

Synonym

Accession P53667 B7Z6I8 D3DXF4 D3DXF5 O15283 Q15820 Q15821 Q75MU3 Q9Y5Q1 LIMK-1
Symbols LIMK
LIMK-1

Gene

PDB

3S95   5HVJ   5HVK   5L6W  

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (78)

PMID Text
25981171 This study showed that LIMK1 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.
25884247 Gene knockdown/rescue experiments reveal that LIMK1 palmitoylation is essential for normal spine actin polymerization, for spine-specific structural plasticity and for long-term spine stability.
25661344 LIMK1 is overexpressed in gastric cancer.
25529997 LIMK1 is overexpressed in endometrial stromal cells.
25359780 CXCL12/CXCR4 signaling has a role in docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIMK1
25344584 Results show that in addition to a potential role in promoting metastasis, changes in LIMK1 and LIMK2 expression and/or activity might contribute to AR function in prostate cancer via regulation of microtubule cytoskeletal dynamics.
25307528 LIMK1 has a role in regulating human trophoblast invasion/differentiation and is down-regulated in preeclampsia
25190487 Data show that the downregulation of miR-138 induced the upregulation of Limk1 in ovarian cancer (OC) cells suggesting that these 2 genes may play a key role in the migration and invasion of OC cells.
25107909 the functional relevance of the LRAP25-MRCK complex in LIMK1-cofilin signaling and the importance of LRAP adaptors as key determinants of MRCK cellular localization and downstream specificities.
25019203 miR-20a is involved in the tumor inhibition of cutaneous squamous cell carcinoma by directly targeting LIMK1 gene.
More...

AA Sequence

MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQL      1 - 70
FCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQ     71 - 140
TVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMS    141 - 210
PDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTP    211 - 280
SGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCF    281 - 350
GQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT    351 - 420
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKT    421 - 490
QPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFG    491 - 560
LNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWE    561 - 630
TYRRGESGLPAHPEVPD                                                         631 - 647
//

Publication (114)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25884247 2015 Palmitoylation of LIM Kinase-1 ensures spine-specific actin polymerization and morphological plasticity.
25661344 2015 Overexpression of LIMK1 promotes tumor growth and metastasis in gastric cancer.
25529997 2015 Effect of LIM kinase 1 overexpression on behaviour of endometriosis-derived stromal cells.
25359780 2014 CXCL12/CXCR4 signaling counteracts docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIM domain kinase 1.
25344584 2015 Elevated LIM kinase 1 in nonmetastatic prostate cancer reflects its role in facilitating androgen receptor nuclear translocation.
25307528 2014 LIMK1 regulates human trophoblast invasion/differentiation and is down-regulated in preeclampsia.
25190487 2014 Upregulation of Limk1 caused by microRNA-138 loss aggravates the metastasis of ovarian cancer by activation of Limk1/cofilin signaling.
25107909 2014 Adaptor protein LRAP25 mediates myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK) regulation of LIMK1 protein in lamellipodial F-actin dynamics.
25019203 2014 MiR-20a inhibits cutaneous squamous cell carcinoma metastasis and proliferation by directly targeting LIMK1.
More...