Property Summary

Ligand Count 639
NCBI Gene PubMed Count 84
PubMed Score 1855.45
PubTator Score 287.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (37)

Disease log2 FC p
adult high grade glioma 1.700 1.8e-03
aldosterone-producing adenoma -1.520 3.2e-02
Astrocytoma, Pilocytic 2.500 4.4e-11
Atopic dermatitis 1.100 2.9e-03
atypical teratoid/rhabdoid tumor 1.100 8.0e-03
breast carcinoma 1.200 2.4e-02
COPD -1.100 5.4e-03
cutaneous lupus erythematosus 2.000 1.4e-03
cystic fibrosis -1.680 2.6e-06
dermatomyositis 1.800 5.9e-03
diabetes mellitus 2.100 1.4e-03
Duchenne muscular dystrophy 1.328 3.3e-07
Endometriosis 1.071 1.5e-02
ependymoma 1.300 1.1e-03
gastric carcinoma 1.800 1.7e-02
glioblastoma 1.800 4.5e-07
interstitial cystitis 1.300 3.0e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.8e-02
invasive ductal carcinoma 1.319 5.7e-04
juvenile dermatomyositis 1.275 5.2e-07
lung adenocarcinoma 1.500 2.6e-07
lung carcinoma -2.700 5.8e-33
malignant mesothelioma -4.100 1.5e-09
medulloblastoma, large-cell 1.100 3.5e-03
nasopharyngeal carcinoma 1.200 6.1e-04
non diabetic and post-ischemic heart fai... -1.300 4.7e-03
ovarian cancer -1.200 2.8e-02
pancreatic cancer -1.100 2.7e-04
pancreatic carcinoma -1.100 2.7e-04
primary pancreatic ductal adenocarcinoma 1.645 1.7e-03
primary Sjogren syndrome 1.200 4.0e-02
psoriasis 3.500 4.0e-06
sonic hedgehog group medulloblastoma 1.500 1.3e-03
subependymal giant cell astrocytoma 2.246 4.7e-02
type II diabetes mellitus and post-ische... -1.200 3.3e-02
ulcerative colitis 1.700 1.8e-07
Waldenstrons macroglobulinemia 1.180 2.9e-03

Gene RIF (44)

AA Sequence

MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQK      1 - 70
LDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGK     71 - 140
KVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSR    141 - 210
KIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQT    211 - 280
PILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGG    281 - 350
FYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGM    351 - 420
DYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL                               421 - 463
//

Text Mined References (93)

PMID Year Title