Property Summary

NCBI Gene PubMed Count 38
PubMed Score 263.69
PubTator Score 126.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
breast carcinoma 1614 1.23438714350013E-11
lung adenocarcinoma 2714 6.16007997072956E-11
non-small cell lung cancer 2798 2.16819301222652E-7
osteosarcoma 7933 1.63459898650119E-6
acute quadriplegic myopathy 1157 1.62538886497948E-5
ovarian cancer 8492 2.09336838634243E-5
psoriasis 6685 2.99760530359366E-5
malignant mesothelioma 3163 4.15556002080853E-5
group 4 medulloblastoma 1875 1.32037506806199E-4
inflammatory breast cancer 404 3.04105996750142E-4
medulloblastoma, large-cell 6234 3.41008556916873E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.0207276280859E-4
oligodendroglioma 2849 8.76735595599146E-4
ependymoma 2514 0.00169935488215842
atypical teratoid / rhabdoid tumor 4369 0.00198165471381203
astrocytic glioma 2241 0.00414927130673828
Gaucher disease type 1 171 0.0066810210998107
diabetes mellitus 1663 0.0072441868394261
glioblastoma 5572 0.00761738017284074
invasive ductal carcinoma 2950 0.0187784855791267
Multiple myeloma 1328 0.0415204706385077
aldosterone-producing adenoma 664 0.0434978224594225
Disease Target Count Z-score Confidence
Menkes disease 20 3.633 1.8
Wilson disease 16 3.59 1.8

Expression

  Differential Expression (22)

Synonym

Accession P53621 Q5T201 Q8IXZ9
Symbols AILJK
HEP-COP

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Xenopus OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (10)

PMID Text
25894502 COPA variants impair binding to proteins targeted for retrograde Golgi-to-ER transport.
25200997 Serum xenin levels of obese patients were higher than in control groups.
24489756 The cell membrane gene SLC4A4 and the trafficking regulator gene COPA, which also plays an important role in early endosome maturation, were identified for the cellular entry of poly-arginine peptide.
23727837 Results show that the interaction between SMN and alpha-COP serves an important function in the growth and maintenance of motor neuron processes and may play a significant role in the pathogenesis of Spinal muscular atrophy.
23199168 Compared with day workers within the same BMI range, night workers presented a disrupted control of ghrelin and xenin, associated with behavioural changes in diet and sleep and increased adiposity and related metabolic alterations.
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit alpha of coatomer protein complex (COPA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into Staufen1 RNP complexes isolated from HIV-1-expressing cells
22335553 Electron tomography reveals Rab6 is essential to the trafficking of trans-Golgi clathrin and COPI-coated vesicles and the maintenance of Golgi cisternal number
21300694 SMN directly binds to COPI and moves with survival motor neuron within axons.
19509059 These results suggested that Yip1A has a role in COPI-independent retrograde transport from the Golgi to the ER and regulates the membrane recruitment of Rab6.
12586295 Among ten hepatocellular carcinoma cases with amplicon 1q21-q22, significant gene expression level of JTB, SHC1, CCT3 and COPA in the tumors than the paired adjacent non-malignant liver tissues.

AA Sequence

MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGG      1 - 70
DDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMC     71 - 140
AQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNW    141 - 210
AAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSK    211 - 280
RTGVQTFRRDHDRFWVLAAHPNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSK    281 - 350
DVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW    351 - 420
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISK    421 - 490
VKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGVFIYTTSNHIKYAVTTGDHGI    491 - 560
IRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQ    561 - 630
KKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNF    631 - 700
DKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEE    701 - 770
AESLKETFDPEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV    771 - 840
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAGGAEDGFFVPP    841 - 910
TKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFLQTYARGRTTYQALPCLPSMY    911 - 980
GYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRSILLSVPLLVVDNKQEIAEA    981 - 1050
QQLITICREYIVGLSVETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKT   1051 - 1120
AATFARRLLELGPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGA   1121 - 1190
CYSPEFKGQICRVTTVTEIGKDVIGLRISPLQFR                                       1191 - 1224
//

Text Mined References (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894502 2015 COPA mutations impair ER-Golgi transport and cause hereditary autoimmune-mediated lung disease and arthritis.
25200997 2014 Evaluation of serum xenin and ghrelin levels and their relationship with nonalcoholic fatty liver disease and insulin resistance in obese adolescents.
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
24489756 2014 COPA and SLC4A4 are required for cellular entry of arginine-rich peptides.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23727837 2013 Dilysine motifs in exon 2b of SMN protein mediate binding to the COPI vesicle protein ?-COP and neurite outgrowth in a cell culture model of spinal muscular atrophy.
23199168 2013 Appetite-regulating hormones from the upper gut: disrupted control of xenin and ghrelin in night workers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...