Property Summary

NCBI Gene PubMed Count 38
Grant Count 40
R01 Count 29
Funding $4,589,923.84
PubMed Score 263.69
PubTator Score 126.01

Knowledge Summary


No data available


  Differential Expression (22)

Gene RIF (13)

25894502 COPA variants impair binding to proteins targeted for retrograde Golgi-to-ER transport.
25200997 Serum xenin levels of obese patients were higher than in control groups.
24489756 The cell membrane gene SLC4A4 and the trafficking regulator gene COPA, which also plays an important role in early endosome maturation, were identified for the cellular entry of poly-arginine peptide.
23727837 Results show that the interaction between SMN and alpha-COP serves an important function in the growth and maintenance of motor neuron processes and may play a significant role in the pathogenesis of Spinal muscular atrophy.
23199168 Compared with day workers within the same BMI range, night workers presented a disrupted control of ghrelin and xenin, associated with behavioural changes in diet and sleep and increased adiposity and related metabolic alterations.
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit alpha of coatomer protein complex (COPA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into Staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit alpha of coatomer protein complex (COPA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into Staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit alpha of coatomer protein complex (COPA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into Staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify subunit alpha of coatomer protein complex (COPA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into Staufen1 RNP complexes isolated from HIV-1-expressing cells
22335553 Electron tomography reveals Rab6 is essential to the trafficking of trans-Golgi clathrin and COPI-coated vesicles and the maintenance of Golgi cisternal number

AA Sequence

CYSPEFKGQICRVTTVTEIGKDVIGLRISPLQFR                                       1191 - 1224

Publication (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894502 2015 COPA mutations impair ER-Golgi transport and cause hereditary autoimmune-mediated lung disease and arthritis.
25200997 2014 Evaluation of serum xenin and ghrelin levels and their relationship with nonalcoholic fatty liver disease and insulin resistance in obese adolescents.
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
24489756 2014 COPA and SLC4A4 are required for cellular entry of arginine-rich peptides.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23727837 2013 Dilysine motifs in exon 2b of SMN protein mediate binding to the COPI vesicle protein ?-COP and neurite outgrowth in a cell culture model of spinal muscular atrophy.
23199168 2013 Appetite-regulating hormones from the upper gut: disrupted control of xenin and ghrelin in night workers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.