Property Summary

NCBI Gene PubMed Count 45
Grant Count 5
R01 Count 1
Funding $1,728,894
PubMed Score 82.57
PubTator Score 33.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.669 0.000
psoriasis 1.200 0.000
osteosarcoma 1.192 0.001
glioblastoma 1.300 0.003
juvenile dermatomyositis 1.149 0.000
acute quadriplegic myopathy 1.034 0.000
diabetes mellitus -1.100 0.004
ovarian cancer 2.100 0.001
dermatomyositis 1.100 0.003

Gene RIF (15)

PMID Text
23559827 HIV-1 Nef utilizes beta-COP in CD28 downregulation
21543478 HIV-1 Nef utilizes beta-COP in CD28 downregulation
21543478 HIV-1 Nef utilizes beta-COP in CD28 downregulation
21543478 HIV-1 Nef utilizes beta-COP in CD28 downregulation
20622010 HIV-1 Nef utilizes beta-COP in CD28 downregulation
19149577 HIV-1 Nef utilizes beta-COP in CD28 downregulation
19149577 HIV-1 Nef utilizes beta-COP in CD28 downregulation
18725938 HIV-1 Nef utilizes beta-COP in CD28 downregulation
18725938 HIV-1 Nef utilizes beta-COP in CD28 downregulation
15202998 HIV-1 Nef utilizes beta-COP in CD28 downregulation
More...

AA Sequence

MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQ      1 - 70
DHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAI     71 - 140
RACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLS    141 - 210
TCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKA    211 - 280
AAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSS    281 - 350
RNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADV    351 - 420
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVE    421 - 490
SEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRPPLRGFLLDGDFFVAASLATT    491 - 560
LTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDI    561 - 630
FNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNT    631 - 700
QRKEAADPLASKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVE    701 - 770
KPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF    771 - 840
RQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVS    841 - 910
IEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI                               911 - 953
//

Text Mined References (59)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24806965 2014 TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22555292 2012 LINC complex alterations in DMD and EDMD/CMT fibroblasts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20551905 2010 A classical NLS and the SUN domain contribute to the targeting of SUN2 to the inner nuclear membrane.
20362547 2010 Enhancement of TREK1 channel surface expression by protein-protein interaction with beta-COP.
More...