Property Summary

NCBI Gene PubMed Count 46
PubMed Score 82.59
PubTator Score 33.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.034 1.8e-05
dermatomyositis 1.100 2.6e-03
diabetes mellitus -1.100 4.3e-03
glioblastoma 1.300 2.6e-03
juvenile dermatomyositis 1.149 6.5e-12
Multiple myeloma 1.669 9.5e-05
osteosarcoma 1.192 1.3e-03
ovarian cancer -1.400 1.4e-07
psoriasis 1.200 2.5e-04

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQ      1 - 70
DHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAI     71 - 140
RACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLS    141 - 210
TCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKA    211 - 280
AAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSS    281 - 350
RNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADV    351 - 420
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVE    421 - 490
SEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRPPLRGFLLDGDFFVAASLATT    491 - 560
LTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDI    561 - 630
FNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNT    631 - 700
QRKEAADPLASKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVE    701 - 770
KPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF    771 - 840
RQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVS    841 - 910
IEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI                               911 - 953
//

Text Mined References (60)

PMID Year Title