Property Summary

NCBI Gene PubMed Count 15
PubMed Score 29.37
PubTator Score 44.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
astrocytoma 1493 2.51244225487008E-23
oligodendroglioma 2849 3.49271785169219E-13
ovarian cancer 8492 1.51195025911782E-9
posterior fossa group B ependymoma 1530 4.28898813737144E-6
glioblastoma 5572 1.05166446583927E-5
pediatric high grade glioma 2712 2.79676168167086E-4
pilocytic astrocytoma 3086 3.6488848352927E-4
lung cancer 4473 0.00288322580633628
osteosarcoma 7933 0.00759455111332684
colon cancer 1475 0.0134258172548627
Breast cancer 3099 0.0215510499526643
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0431503179705159
subependymal giant cell astrocytoma 2287 0.043294749770459

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 0.000
glioblastoma 1.400 0.000
oligodendroglioma 1.100 0.000
osteosarcoma -1.398 0.008
posterior fossa group B ependymoma 1.500 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.043
colon cancer -1.300 0.013
lung cancer -1.500 0.003
Breast cancer 4.100 0.022
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.100 0.000
subependymal giant cell astrocytoma 1.948 0.043
ovarian cancer -1.500 0.000

Synonym

Accession P53609 Q5MJP9
Symbols BGGI
GGTI

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Pathway (1)

Gene RIF (8)

PMID Text
23475391 our study showed, for the first time, that HIF-1alpha was regulated by protein prenylation transferase GGTI and mediated the effect of GGTI on glioma cell migration and invasion
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of protein geranylgeranyltransferase type I, beta subunit (PGGT1B) in U-937 macrophages
22160308 our findings identify Geranylgeranyl transferase 1 as a key regulator of human airway smooth muscle cell viability
20446922 RNAi knockdown of GGTase-Ibeta inhibited invasion, disrupted F-actin organization and decreased the level of cofilin in PC-3 cells.
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19667218 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15451670 Results suggest that all peptide substrates adopt a common binding mode in the protein farnesyltransferase and geranylgeranyltransferase active site.
14598891 results suggest that geranylgeranylation of RhoA is critical for cancer cell invasion

AA Sequence

MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKD      1 - 70
DIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSGHIAMTYTGLSCLVILGDDLS     71 - 140
RVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASCICYMLNNWSGMDMKKAITYIRRSMSYDNGL    141 - 210
AQGAGLESHGGSTFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATL    211 - 280
KLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRT    281 - 350
SERLLDLHQSWKTKDSKQCSENVHIST                                               351 - 377
//

Text Mined References (17)

PMID Year Title
23475391 2013 Geranylgeranyltransferase I regulates HIF-1? promoting glioblastoma cell migration and invasion.
22160308 2012 Geranylgeranyl transferase 1 modulates autophagy and apoptosis in human airway smooth muscle.
21269460 2011 Initial characterization of the human central proteome.
20446922 2010 Inhibition of GGTase-I and FTase disrupts cytoskeletal organization of human PC-3 prostate cancer cells.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
19667218 2009 Genome-wide scan of 500,000 single-nucleotide polymorphisms among responders and nonresponders to interferon beta therapy in multiple sclerosis.
16893176 2006 Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15451670 2004 Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...