Property Summary

Ligand Count 23
NCBI Gene PubMed Count 15
PubMed Score 29.41
PubTator Score 44.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.100 7.0e-03
astrocytoma 1.200 2.5e-23
Astrocytoma, Pilocytic 1.100 4.5e-04
Breast cancer 4.100 2.2e-02
colon cancer -1.300 1.3e-02
ependymoma 1.100 1.7e-05
glioblastoma 1.400 1.1e-05
intraductal papillary-mucinous neoplasm ... 1.100 4.3e-02
lung cancer -1.500 2.9e-03
oligodendroglioma 1.100 3.5e-13
osteosarcoma -1.398 7.6e-03
ovarian cancer -1.500 1.5e-09
subependymal giant cell astrocytoma 1.948 4.3e-02

Gene RIF (8)

AA Sequence

MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKD      1 - 70
DIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSGHIAMTYTGLSCLVILGDDLS     71 - 140
RVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASCICYMLNNWSGMDMKKAITYIRRSMSYDNGL    141 - 210
AQGAGLESHGGSTFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATL    211 - 280
KLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRT    281 - 350
SERLLDLHQSWKTKDSKQCSENVHIST                                               351 - 377
//

Text Mined References (17)

PMID Year Title