Property Summary

NCBI Gene PubMed Count 24
PubMed Score 99.03
PubTator Score 362.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.8
Disease Target Count Z-score Confidence
Leigh disease 100 3.631 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.054 2.3e-03
osteosarcoma 1.252 3.7e-04
ovarian cancer -1.300 7.1e-05
pancreatic ductal adenocarcinoma liver m... -1.186 1.2e-02
ulcerative colitis -1.100 1.6e-06

 GO Process (1)

Protein-protein Interaction (5)

Gene RIF (9)

AA Sequence

MTATLAAAADIATMVSGSSGLAAARLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTF      1 - 70
HSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLV     71 - 140
VCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAV    141 - 210
HQTTQVGLGQSLCVGIGGDPFNGTDFIDCLEIFLNDSATEGIILIGEIGGNAEENAAEFLKQHNSGPNSK    211 - 280
PVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML        281 - 346
//

Text Mined References (30)

PMID Year Title