Property Summary

Ligand Count 65
NCBI Gene PubMed Count 18
PubMed Score 44.38
PubTator Score 18.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 2.4e-18
ovarian cancer 8520 7.5e-07
psoriasis 6694 1.8e-04
interstitial cystitis 2312 3.9e-04
lung cancer 4740 6.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Babesiosis 14 3.487 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.300 3.9e-04
lung cancer 1.500 6.2e-04
non-small cell lung cancer 1.055 2.4e-18
ovarian cancer -1.200 7.5e-07
psoriasis 1.600 1.8e-04

Synonym

Accession P53582 B4E2E6 MAP 1
Symbols MAP1A
MetAP1A

Gene

PDB

2B3H   2B3K   2B3L   2G6P   2GZ5   2NQ6   2NQ7   4FLI   4FLJ   4FLK   4FLL   4HXX   4IKR   4IKS   4IKT   4IKU   4IU6   4U1B   4U69   4U6C   4U6E   4U6J   4U6W   4U6Z   4U70   4U71   4U73   4U75   4U76  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVE      1 - 70
GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMR     71 - 140
LVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRP    141 - 210
LQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHA    211 - 280
QANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRD    281 - 350
GKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF                                      351 - 386
//

Text Mined References (25)

PMID Year Title