Property Summary

NCBI Gene PubMed Count 18
Grant Count 17
R01 Count 10
Funding $2,029,330.17
PubMed Score 25.72
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.600 0.000
non-small cell lung cancer 1.055 0.000
lung cancer 1.500 0.001
interstitial cystitis -1.400 0.000
ovarian cancer -1.200 0.000

Gene RIF (8)

PMID Text
23767698 Data indicate that pyridinylpyrimidine-based molecules displayed species specificity behavior against methionine aminopeptidases (MetAPs).
20521764 the substrate specificities of Escherichia coli MetAP1, human MetAP1, and human MetAP2 were systematically profiled
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
17929833 Human MetAP1 is distinct from other members of the MetAP superfamily in the number of metal ions employed and likely mechanism of catalysis.
17114291 results suggest that MetAP1 plays an important role in G(2)/M phase of the cell cycle and that it may serve as a promising target for the discovery and development of new anticancer agents
16274222 A comparison of the structual differences between Type I and Type II methionine aminopeptidases.
12144506 Data show that human methionine aminopeptidase 1 (MetAP1) fully rescued the slow growth phenotype associated with deletion of yeast MetAP1, suggesting that the yeast and human proteins may have similar roles in vivo.

AA Sequence

MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVE      1 - 70
GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMR     71 - 140
LVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRP    141 - 210
LQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHA    211 - 280
QANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRD    281 - 350
GKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF                                      351 - 386
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23767698 2013 Identification, biochemical and structural evaluation of species-specific inhibitors against type I methionine aminopeptidases.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
21269460 2011 Initial characterization of the human central proteome.
20521764 2010 Protein N-terminal processing: substrate specificity of Escherichia coli and human methionine aminopeptidases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17929833 2007 Kinetic and mutational studies of the number of interacting divalent cations required by bacterial and human methionine aminopeptidases.
More...