Property Summary

NCBI Gene PubMed Count 40
PubMed Score 409.68
PubTator Score 229.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.31609668665771E-18
breast carcinoma 1614 9.06301339481958E-17
lung carcinoma 2844 1.54547372195553E-11
inflammatory breast cancer 404 2.30572238576289E-11
lung cancer 4473 4.49697064763218E-8
lung adenocarcinoma 2714 2.55315615896029E-6
adrenocortical carcinoma 1427 2.4498856742081E-5
psoriasis 6685 1.52311771840215E-4
nephrosclerosis 329 3.6658702537874E-4
Rheumatoid Arthritis 1171 0.00330173582139609
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0034844767240994
Waldenstrons macroglobulinemia 765 0.00351105544571058
hepatocellular carcinoma 550 0.00368964446573389
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0083455789020824
ovarian cancer 8492 0.0109794008710714
colon cancer 1475 0.0122677879457383
non primary Sjogren syndrome sicca 840 0.0124272228173805
aldosterone-producing adenoma 664 0.0163027918419911
acute myeloid leukemia 785 0.0163452230482975
pterygium 74 0.0189139505738775
gastric carcinoma 832 0.0192317212226279
invasive ductal carcinoma 2950 0.0261204965787591
atypical teratoid/rhabdoid tumor 1095 0.0291150565991294
ulcerative colitis 2087 0.0301416042673853
ductal carcinoma in situ 1745 0.0301534475438803
pituitary cancer 1972 0.0321379579691383
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0352392266366108
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0428030881285443
adrenocortical adenoma 134 0.0458872013739196
group 4 medulloblastoma 1875 0.0494341133946964

Expression

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (27)

PMID Text
25446562 studies of FosB are providing new insight into the molecular basis of depression and antidepressant action.
25043949 The abnormalities were screened by FISH in 44 epithelioid hemangioma (EH) from different locations with seven additional EH revealing FOSB gene rearrangements, all except one being fused to ZFP36.
24551192 HIV-1 Vpu-expressing U937 monocytes coculture with LX2 stellate cells to activate release of transforming growth factor beta to culture supernatant, which correlates with increased activity of the AP-1 transcription factor
24374978 Pseudomyogenic haemangioendothelioma consistently displays a SERPINE1-FOSB fusion gene, resulting from a translocation between chromosomes 7 and 19.
23933656 This study describing the expres-sion pattern of FosB/ FosB immunoreactivity inpost mortem basal ganglia sections from Parkinson disease patients.
23810250 Data indicate a significant correlation in miR-181b, FOS and miR-21 expression glioma tissues.
23614275 Report Fos-B expression in skin keratinocytes/fibroblasts and keloid fibroblasts exposed to genistein.
21616539 Induction of a DeltaFOSB mediated transcriptional pattern in the prefrontal cortex is opposite to the down-regulation observed in the nucleus accumbens in patients with major depressive disorder
21543584 AP-1 protein induction during monopoiesis favors C/EBP: AP-1 heterodimers over C/EBP homodimerization and stimulates FosB transcription.
20826776 Findings indicate that neurobehavioral stress leads to FosB-driven increases in IL8, which is associated with increased tumor growth and metastases.
More...

AA Sequence

MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWL      1 - 70
VQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARA     71 - 140
RPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKER    141 - 210
LEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASL    211 - 280
FTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL                281 - 338
//

Text Mined References (42)

PMID Year Title
25446562 2015 ?FosB: a transcriptional regulator of stress and antidepressant responses.
25043949 2014 ZFP36-FOSB fusion defines a subset of epithelioid hemangioma with atypical features.
24374978 2014 A novel SERPINE1-FOSB fusion gene results in transcriptional up-regulation of FOSB in pseudomyogenic haemangioendothelioma.
23933656 2011 Putaminal upregulation of FosB/?FosB-like immunoreactivity in Parkinson's disease patients with dyskinesia.
23810250 2013 Involvement of FOS-mediated miR-181b/miR-21 signalling in the progression of malignant gliomas.
23614275 Influence of genistein on c-Jun, c-Fos and Fos-B of AP-1 subunits expression in skin keratinocytes, fibroblasts and keloid fibroblasts cultured in vitro.
21616539 2011 Activation of a ?FOSB dependent gene expression pattern in the dorsolateral prefrontal cortex of patients with major depressive disorder.
21543584 2011 AP-1 protein induction during monopoiesis favors C/EBP: AP-1 heterodimers over C/EBP homodimerization and stimulates FosB transcription.
20826776 2010 Stress effects on FosB- and interleukin-8 (IL8)-driven ovarian cancer growth and metastasis.
20813842 2010 Activation of the transcription factor FosB/activating protein-1 (AP-1) is a prominent downstream signal of the extracellular nucleotide receptor P2RX7 in monocytic and osteoblastic cells.
More...