Property Summary

NCBI Gene PubMed Count 40
Grant Count 254
R01 Count 154
Funding $37,939,485.59
PubMed Score 409.68
PubTator Score 229.11

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (1)

Gene RIF (27)

PMID Text
25446562 studies of FosB are providing new insight into the molecular basis of depression and antidepressant action.
25043949 The abnormalities were screened by FISH in 44 epithelioid hemangioma (EH) from different locations with seven additional EH revealing FOSB gene rearrangements, all except one being fused to ZFP36.
24551192 HIV-1 Vpu-expressing U937 monocytes coculture with LX2 stellate cells to activate release of transforming growth factor beta to culture supernatant, which correlates with increased activity of the AP-1 transcription factor
24374978 Pseudomyogenic haemangioendothelioma consistently displays a SERPINE1-FOSB fusion gene, resulting from a translocation between chromosomes 7 and 19.
23933656 This study describing the expres-sion pattern of FosB/ FosB immunoreactivity inpost mortem basal ganglia sections from Parkinson disease patients.
23810250 Data indicate a significant correlation in miR-181b, FOS and miR-21 expression glioma tissues.
23614275 Report Fos-B expression in skin keratinocytes/fibroblasts and keloid fibroblasts exposed to genistein.
21616539 Induction of a DeltaFOSB mediated transcriptional pattern in the prefrontal cortex is opposite to the down-regulation observed in the nucleus accumbens in patients with major depressive disorder
21543584 AP-1 protein induction during monopoiesis favors C/EBP: AP-1 heterodimers over C/EBP homodimerization and stimulates FosB transcription.
20826776 Findings indicate that neurobehavioral stress leads to FosB-driven increases in IL8, which is associated with increased tumor growth and metastases.
More...

AA Sequence

MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWL      1 - 70
VQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARA     71 - 140
RPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKER    141 - 210
LEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASL    211 - 280
FTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL                281 - 338
//

Publication (42)

PMID Year Title
25446562 2015 ?FosB: a transcriptional regulator of stress and antidepressant responses.
25043949 2014 ZFP36-FOSB fusion defines a subset of epithelioid hemangioma with atypical features.
24374978 2014 A novel SERPINE1-FOSB fusion gene results in transcriptional up-regulation of FOSB in pseudomyogenic haemangioendothelioma.
23933656 2011 Putaminal upregulation of FosB/?FosB-like immunoreactivity in Parkinson's disease patients with dyskinesia.
23810250 2013 Involvement of FOS-mediated miR-181b/miR-21 signalling in the progression of malignant gliomas.
23614275 Influence of genistein on c-Jun, c-Fos and Fos-B of AP-1 subunits expression in skin keratinocytes, fibroblasts and keloid fibroblasts cultured in vitro.
21616539 2011 Activation of a ?FOSB dependent gene expression pattern in the dorsolateral prefrontal cortex of patients with major depressive disorder.
21543584 2011 AP-1 protein induction during monopoiesis favors C/EBP: AP-1 heterodimers over C/EBP homodimerization and stimulates FosB transcription.
20826776 2010 Stress effects on FosB- and interleukin-8 (IL8)-driven ovarian cancer growth and metastasis.
20813842 2010 Activation of the transcription factor FosB/activating protein-1 (AP-1) is a prominent downstream signal of the extracellular nucleotide receptor P2RX7 in monocytic and osteoblastic cells.
More...