Property Summary

NCBI Gene PubMed Count 51
PubMed Score 432.20
PubTator Score 229.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Juvenile arthritis 126
Mood Disorders 184

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia 1.600 1.6e-02
adrenocortical adenoma -1.401 4.6e-02
adrenocortical carcinoma -2.873 2.4e-05
aldosterone-producing adenoma -2.127 1.6e-02
atypical teratoid/rhabdoid tumor -1.100 2.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.412 4.3e-02
Breast cancer -3.500 2.4e-02
breast carcinoma -1.400 3.7e-02
colon cancer -3.300 1.2e-02
ductal carcinoma in situ -1.900 3.0e-02
gastric cancer -2.000 2.6e-02
group 4 medulloblastoma -1.500 4.9e-02
hepatocellular carcinoma -1.700 3.7e-03
intraductal papillary-mucinous adenoma (... -1.600 3.5e-02
intraductal papillary-mucinous carcinoma... -2.800 3.5e-03
intraductal papillary-mucinous neoplasm ... -3.100 8.3e-03
invasive ductal carcinoma -2.000 2.6e-02
lung adenocarcinoma -1.700 3.4e-06
lung cancer -5.500 2.6e-08
lung carcinoma -3.500 1.5e-11
nephrosclerosis -2.156 3.7e-04
non primary Sjogren syndrome sicca -2.300 1.2e-02
non-small cell lung cancer -3.729 1.3e-18
ovarian cancer 2.000 1.1e-02
pituitary cancer -1.400 3.2e-02
psoriasis -2.200 1.5e-04
pterygium -2.300 1.9e-02
Rheumatoid arthritis 2.700 3.3e-03
ulcerative colitis 1.500 3.0e-02
Waldenstrons macroglobulinemia 1.761 3.5e-03

Protein-protein Interaction (1)

Gene RIF (37)

AA Sequence

MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWL      1 - 70
VQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARA     71 - 140
RPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKER    141 - 210
LEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASL    211 - 280
FTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL                281 - 338
//

Text Mined References (53)

PMID Year Title