Property Summary

Ligand Count 18
NCBI Gene PubMed Count 61
PubMed Score 654.34
PubTator Score 190.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.123 3.3e-05
astrocytoma 1.700 2.6e-03
Astrocytoma, Pilocytic 1.200 7.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.011 3.3e-03
Breast cancer 2.400 2.6e-02
group 3 medulloblastoma 1.700 1.7e-04
juvenile dermatomyositis 1.297 1.1e-12
lung adenocarcinoma 1.198 2.7e-06
medulloblastoma, large-cell 2.200 3.8e-07
Multiple myeloma 1.329 4.3e-03
non primary Sjogren syndrome sicca 1.800 1.5e-02
osteosarcoma 1.074 1.0e-02
ovarian cancer 2.600 4.6e-06
posterior fossa group A ependymoma 1.100 2.3e-04
psoriasis 1.600 8.0e-04
Waldenstrons macroglobulinemia 1.210 2.3e-02

 MGI Phenotype (1)

Gene RIF (39)

AA Sequence

MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLG      1 - 70
LVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGV     71 - 140
DVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKD    141 - 210
GVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVA    211 - 280
GGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNV    281 - 350
AATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG    351 - 420
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKST    421 - 490
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAM    491 - 560
RKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATVGGIK    561 - 630
PGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDH    631 - 700
VLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASE    701 - 770
TAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASF    771 - 840
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNT    841 - 910
IICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLIMGIGHRVKSI    911 - 980
NNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNCGSFTREEADE    981 - 1050
YIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMSM                      1051 - 1101
//

Text Mined References (75)

PMID Year Title