Property Summary

NCBI Gene PubMed Count 55
PubMed Score 638.40
PubTator Score 190.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver carcinoma 217
Obesity 616
Disease Target Count P-value
juvenile dermatomyositis 1189 1.14394128994466E-12
medulloblastoma, large-cell 6234 1.16365625369017E-7
group 4 medulloblastoma 1875 7.74925436516086E-7
lung adenocarcinoma 2714 2.67367944628295E-6
ovarian cancer 8492 4.58478166786128E-6
acute quadriplegic myopathy 1157 3.32281877815477E-5
posterior fossa group A ependymoma 1511 2.28968151196967E-4
osteosarcoma 7933 3.69164430526269E-4
pilocytic astrocytoma 3086 6.75626266407535E-4
psoriasis 6685 8.03844501937051E-4
astrocytoma 1493 0.0026166382097571
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00328727231853472
Multiple myeloma 1328 0.00432130601363552
non primary Sjogren syndrome sicca 840 0.0146549240445345
Waldenstrons macroglobulinemia 765 0.0231345972395475
Breast cancer 3099 0.0260299803310367

Expression

Synonym

Accession P53396 B4DIM0 B4E3P0 Q13037 Q9BRL0
Symbols ACL
ATPCL
CLATP

Gene

PANTHER Protein Class (1)

PDB

3MWD   3MWE   3PFF  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (33)

PMID Text
26452058 ACC1 and ACLY regulate the levels of ETV4 under hypoxia via increased alpha-ketoglutarate. These results reveal that the ACC1/ACLY-alpha-ketoglutarate-ETV4 axis is a novel means by which metabolic states regulate transcriptional output
26039450 ACL activity is associated with increased ATP. Activation of this IGF1/ACL/cardiolipin pathway combines anabolic signaling with induction of mechanisms needed to provide required ATP.
25890184 Polymorphisms of ATP citrate lyase gene is associated with recurrence in colorectal cancer.
25837797 These results suggest that the combined expression of GLUT1 and ACLY could be a more valuable prognostic factor than their individual expression in node-negative patients with NSCLC.
25735330 SNP rs9912300 in ACLY gene was significantly associated with response to therapy in hepatocellular carcinoma
25367309 The activation of AMPK under ACLY knockdown conditions may lead to p53 activation, ultimately leading to cellular senescence.
24310723 These data indicate that inhibition of ACLY might affect both fatty acid elongation in ER and FAO in mitochondria, thereby explaining the TG accumulation with altered fatty acid composition.
24132143 ATP citrate lyase mediates resistance of colorectal cancer cells to SN38.
24051091 ACLY mRNA and protein levels markedly and quickly increase in activated macrophages. Importantly, ACLY activity inhibition as well as ACLY gene silencing lead to reduced nitric oxide, reactive oxygen species and prostaglandin E2 inflammatory mediators.
23886516 Single nucleotide polymorphisms in the ACACA and ACLY genes are associated with a relative change in plasma triglycierides following fish oil supplementation.
More...

AA Sequence

MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLG      1 - 70
LVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGV     71 - 140
DVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKD    141 - 210
GVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVA    211 - 280
GGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNV    281 - 350
AATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG    351 - 420
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKST    421 - 490
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAM    491 - 560
RKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATVGGIK    561 - 630
PGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDH    631 - 700
VLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASE    701 - 770
TAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASF    771 - 840
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNT    841 - 910
IICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLIMGIGHRVKSI    911 - 980
NNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNCGSFTREEADE    981 - 1050
YIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMSM                      1051 - 1101
//

Text Mined References (69)

PMID Year Title
26452058 2015 ACLY and ACC1 Regulate Hypoxia-Induced Apoptosis by Modulating ETV4 via ?-ketoglutarate.
26039450 2015 ATP citrate lyase improves mitochondrial function in skeletal muscle.
25890184 2015 Functional polymorphisms of ATP citrate lyase gene predicts clinical outcome of patients with advanced colorectal cancer.
25837797 2015 Prognostic impact of the combination of glucose transporter 1 and ATP citrate lyase in node-negative patients with non-small lung cancer.
25735330 2015 Polymorphisms in genes of the de novo lipogenesis pathway and overall survival of hepatocellular carcinoma patients undergoing transarterial chemoembolization.
25367309 2015 ATP-citrate lyase regulates cellular senescence via an AMPK- and p53-dependent pathway.
24310723 2014 Inhibition of ATP citrate lyase induces triglyceride accumulation with altered fatty acid composition in cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132143 2013 ATP citrate lyase mediates resistance of colorectal cancer cells to SN38.
24051091 2013 ATP-citrate lyase is essential for macrophage inflammatory response.
More...