Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.96
PubTator Score 17.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 5.17852886217961E-5
osteosarcoma 7933 8.52832333678712E-4
primitive neuroectodermal tumor 3031 0.00151302313956162
group 3 medulloblastoma 2254 0.00166103603603758
glioblastoma 5572 0.00375897045725555
Disease Target Count Z-score Confidence
Syndactyly 56 3.555 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.238 0.001
glioblastoma 1.200 0.004
primitive neuroectodermal tumor 1.100 0.002
group 3 medulloblastoma 1.100 0.002
ovarian cancer 1.100 0.000

Synonym

Accession P53384 Q32M30 Q498A9 Q53FS7
Symbols NBP
NBP1
NBP35

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (4)

PMID Text
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18573874 The cytosolic soluble P-loop NTPase termed huNbp35 (also known as Nubp1) was identified as an Fe/S protein, and its role in the maturation of Fe/S proteins in HeLa cells, is defined.

AA Sequence

MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKST      1 - 70
FSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDD     71 - 140
AVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVR    141 - 210
KEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG    211 - 280
QSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS                                  281 - 320
//

Text Mined References (17)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18573874 2008 Human Nbp35 is essential for both cytosolic iron-sulfur protein assembly and iron homeostasis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...