Property Summary

NCBI Gene PubMed Count 12
Grant Count 44
R01 Count 29
Funding $12,774,868.7
PubMed Score 18.96
PubTator Score 17.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.238 0.001
glioblastoma 1.200 0.004
primitive neuroectodermal tumor 1.100 0.002
group 3 medulloblastoma 1.100 0.002
ovarian cancer 1.100 0.000

Gene RIF (4)

PMID Text
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18573874 The cytosolic soluble P-loop NTPase termed huNbp35 (also known as Nubp1) was identified as an Fe/S protein, and its role in the maturation of Fe/S proteins in HeLa cells, is defined.

AA Sequence

MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKST      1 - 70
FSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDD     71 - 140
AVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVR    141 - 210
KEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG    211 - 280
QSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS                                  281 - 320
//

Text Mined References (17)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18573874 2008 Human Nbp35 is essential for both cytosolic iron-sulfur protein assembly and iron homeostasis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...