Property Summary

NCBI Gene PubMed Count 192
Grant Count 67
R01 Count 37
Funding $5,416,045.09
PubMed Score 206.02
PubTator Score 307.56

Knowledge Summary

Patent (11,312)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.300 0.023
ependymoma 1.400 0.024
oligodendroglioma 1.100 0.021
psoriasis -1.200 0.013
glioblastoma -1.400 0.001
cystic fibrosis -1.642 0.000
atypical teratoid / rhabdoid tumor -1.400 0.002
medulloblastoma, large-cell -1.100 0.028
tuberculosis and treatment for 6 months -1.400 0.009
non-small cell lung cancer -1.955 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.001
X-linked cerebral adrenoleukodystrophy -2.600 0.014
lung cancer -6.100 0.000
pediatric high grade glioma -1.100 0.002
group 4 medulloblastoma 1.200 0.004
pilocytic astrocytoma -1.800 0.000
invasive ductal carcinoma 1.649 0.000
COPD -1.200 0.019
ovarian cancer -4.600 0.000

Gene

PDB

1IG1   1JKK   1JKL   1JKS   1JKT   1P4F   1WVW   1WVX   1WVY   1YR5   2W4J   2W4K   2X0G   2XUU   2XZS   2Y0A   2Y4P   2Y4V   2YAK   3DFC   3DGK   3EH9   3EHA   3F5G   3F5U   3GU4   3GU5   3GU6   3GU7   3GU8   3GUB   3ZXT   4B4L   4PF4   4TL0   4TXC   4UV0   4YO4   4YPD   5AUT   5AUU   5AUV   5AUW   5AUX   5AUY   5AUZ   5AV0   5AV1   5AV2   5AV3   5AV4  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 IMPC Term (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (172)

PMID Text
26823825 testing for DNA methylations of MGMT plus DAPK1 genes holds some promise for high grade cervical disease screening
26810771 DAPK-1 and MLH1 methylation correlated inversely in tumors in the middle-third of the stomach
26626260 Results show that CYP1B1 may promote renal cell carcinoma development by inducing CDC20 expression and inhibiting apoptosis through the down-regulation of DAPK1.
26406950 Our meta-analysis results reveal that DAPK promoter methylation might be associated with tumor metastasis and poor prognosis in NSCLC patients, although no correlation with histological types and TNM stage in NSCLC patients were found.
26267895 A significant strong association between DAPK1 promoter methylation and CC was shown and confirmed independently by histological tumor type, method used to evaluate methylation and source of control samples.
26213212 Results identified MGMT and DAPK1 as predictors of nodal metastasis in oral and oropharyngeal squamous cell carcinoma with a high predictive value and specificity and sensitivity.
26191186 miR-191-DAPK1 axis may play an important role modulating the response of ovarian endometriosis and endometrioid carcinoma cells to TNF-alpha.
26165472 DAPK1 is highly expressed in the peritumoral region of glioblastoma multiforme brain neoplasms.
26100670 Besides mediating the anticancer effect, pDAPK(S308) may serve as a predictive biomarker for Raf inhibitors combination therapy, suggesting an ideal preclinical model that is worthy of clinical translation.
26075823 high DAPK1 expression causes increased cancer cell growth and enhanced signaling via the mTOR/S6K pathway; evaluation of breast cancer patient data sets revealed that high DAPK1 expression associates with worse outcomes in women with p53-mutant cancers
More...

AA Sequence

MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKE      1 - 70
IQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDL     71 - 140
KPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL    141 - 210
LSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDT    211 - 280
QQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH    281 - 350
AINDDNVPGLQHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA    351 - 420
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEETPLHCAAWHGY    421 - 490
YSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNACDKDGHIALHLAVRRCQMEVI    491 - 560
KTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEANCNLDISNKYGRTPLHLAANNGILDVVRYLC    561 - 630
LMGASVEALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGK    631 - 700
TTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLT    701 - 770
KGMLEVFVAPTHHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF    771 - 840
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGGEFGYDKDTSL    841 - 910
LKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCPPMTHLCEKIISTLPSWRKLN    911 - 980
GPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGEINIMQSETVQDVLLLDPRWLCTNVLGKLLS    981 - 1050
VETPRALHHYRGRYTVEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEE   1051 - 1120
DEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNH   1121 - 1190
GQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA   1191 - 1260
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLL   1261 - 1330
AMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKASSVFK   1331 - 1400
INLDGNGQEAYASSCNSGTSYNSISSVVSR                                           1401 - 1430
//

Text Mined References (207)

PMID Year Title
26823825 2015 DAPK1, MGMT and RARB promoter methylation as biomarkers for high-grade cervical lesions.
26810771 2016 Gene methylation profile of gastric cancerous tissue according to tumor site in the stomach.
26626260 2015 CYP1B1 promotes tumorigenesis via altered expression of CDC20 and DAPK1 genes in renal cell carcinoma.
26406950 2015 DAPK promoter methylation status correlates with tumor metastasis and poor prognosis in patients with non-small cell lung cancer.
26267895 2015 DAPK1 Promoter Methylation and Cervical Cancer Risk: A Systematic Review and a Meta-Analysis.
26213212 2015 Identification of methylation markers for the prediction of nodal metastasis in oral and oropharyngeal squamous cell carcinoma.
26191186 2015 MiR-191 inhibits TNF-? induced apoptosis of ovarian endometriosis and endometrioid carcinoma cells by targeting DAPK1.
26165472 2015 Activation of death-associated protein kinase in human peritumoral tissue: A potential therapeutic target.
26100670 2015 Novel Cancer Therapeutics with Allosteric Modulation of the Mitochondrial C-Raf-DAPK Complex by Raf Inhibitor Combination Therapy.
26075823 2015 Death-associated protein kinase 1 promotes growth of p53-mutant cancers.
More...