Property Summary

NCBI Gene PubMed Count 60
Grant Count 9
Funding $194,568.6
PubMed Score 52.05
PubTator Score 109.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 1.332 0.000
lung cancer 1.300 0.001
subependymal giant cell astrocytoma -1.117 0.017

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
463222 other 4 / 0 / 61 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5
463223 other 4 / 0 / 60 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5
463224 confirmatory 2 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5
624425 confirmatory 7 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5)
624432 confirmatory 0 / 0 / 2 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5) (12.7 nM low dose)
624433 confirmatory 4 / 0 / 3 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5) (3.8nM low dose)
624434 other 14 / 0 / 11 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5)
624435 other 6 / 0 / 30 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5 (Round 5)
624439 confirmatory 5 / 0 / 3 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5 (Round 5)
624448 confirmatory 0 / 0 / 8 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5) (1uM low dose)

Gene RIF (30)

PMID Text
26157124 Measles Virus Infection Inactivates Cellular Protein Phosphatase 5 with Consequent Suppression of Sp1 and c-Myc Activities.
25796168 PPP5C could be essential for glioma cell growth.
25326185 We demonstrate for the first time that PPP5C is essential for growth of HCC cells, which suggests that inhibition of PPP5C by RNAi may be a potential therapeutic strategy for the treatment of hepatocellular carcinoma.
25322973 the importance of PP5 in CRC cell growth
25269953 Data indicate that Cu-oxidized S100 calcium binding protein A4 (S100A4) interacted with S100 calcium binding protein A1 (S100A1) and prevented protein phosphatase 5 (PP5) activation.
24327656 These results demonstrate that Hsp70 recruits PP5 and activates its phosphatase activity which suggests dual roles for PP5 that might link chaperone systems with signaling pathways in cancer and development.
23352616 these results suggest that caveolin-1 is a novel physiological activator of PP5.
23184943 Chp-1 and melusin can interact with cochaperones PP5 and Sgt1 and with each other in an ATP-dependent manner
23102700 Suggest that Slim/KLHDC10 is an activator of ASK1, contributing to oxidative stress-induced cell death through the suppression of PP5.
22592921 proasthmatic cytokine-induced corticosteroid insensitivity in airway smooth muscle cells is due, in part, to PP5-mediated impairment of glucocorticoid receptor-Ser211 phosphorylation.
More...

AA Sequence

MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSL      1 - 70
AYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECN     71 - 140
KIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAY    141 - 210
QILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSV    211 - 280
EVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLI    281 - 350
MHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL    351 - 420
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA    421 - 490
NTLLQLGMM                                                                 491 - 499
//

Text Mined References (69)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26157124 2015 Measles Virus Infection Inactivates Cellular Protein Phosphatase 5 with Consequent Suppression of Sp1 and c-Myc Activities.
25796168 2015 Serine/Threonine Protein Phosphatase-5 Accelerates Cell Growth and Migration in Human Glioma.
25326185 2015 Knockdown of PPP5C inhibits growth of hepatocellular carcinoma cells in vitro.
25322973 Inhibition of protein phosphatase 5 (PP5) suppresses survival and growth of colorectal cancer cells.
25269953 2014 Oxidized S100A4 inhibits the activation of protein phosphatase 5 through S100A1 in MKN?45 gastric carcinoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24327656 2014 The molecular chaperone Hsp70 activates protein phosphatase 5 (PP5) by binding the tetratricopeptide repeat (TPR) domain.
23352616 2013 Caveolin-1 interacts with protein phosphatase 5 and modulates its activity in prostate cancer cells.
More...