Property Summary

NCBI Gene PubMed Count 41
Grant Count 21
R01 Count 19
Funding $3,478,025.95
PubMed Score 163.40
PubTator Score 76.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
systemic lupus erythematosus 1.300 0.000
malignant mesothelioma -4.200 0.000
Barrett's esophagus -1.200 0.026
esophageal adenocarcinoma -1.600 0.021
psoriasis -1.100 0.004
tuberculosis 1.700 0.000
lung cancer -1.300 0.003
active Crohn's disease 3.024 0.001
active ulcerative colitis 2.721 0.003
group 3 medulloblastoma 1.400 0.007
lung carcinoma -1.200 0.000
acute myeloid leukemia -2.500 0.006
ovarian cancer -1.600 0.000
Gaucher disease type 1 -1.100 0.047

Gene RIF (27)

PMID Text
25726384 Data suggest that isoenzymes BVRA and BVRB play different roles in energy metabolism and in pathogenesis of abdominal obesity and hypertriglyceridemia. [REVIEW]
25196843 Interactions of HO-2 with CPR and BVR, were evaluated.
24222129 Increased biliverdin reductase expression is associated with multidrug resistance in leukemia.
24113378 These findings suggest that hBVR significantly contributes to the modulation of hypoxia-induced chemoresistance of glioblastoma cells by adjusting their cellular redox status.
24060811 Activation of human biliverdin-IXalpha reductase by urea: generation of kinetically distinct forms during the unfolding pathway.
23536765 Our results suggest that patients with chronic HCV infection significantly upregulate BLVRA expression in PBL.
22776971 The current study reports increased levels of both HO-1 and BVR-A in plasma from probable Alzheimer disease patients, as a result of the increased oxidative environment.
21721974 rs699512 (Thr3Ala), the only common non-synonymous SNP within BLVRA, reduced the risk of essential hypertension in Kazaks.
21483094 A significant increase of nitrated BVRA was demonstrated only in Alzheimer's disease and mild cognitive impairment hippocampi
21278388 A homozygous BLVRA inactivating mutation is associated with the appearance of green jaundice accompanying cholestasis episodes.
More...

AA Sequence

MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEV      1 - 70
AYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEV     71 - 140
VGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKK    141 - 210
SPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILH    211 - 280
CLGLAEEIQKYCCSRK                                                          281 - 296
//

Text Mined References (50)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726384 2015 Biliverdin reductase isozymes in metabolism.
25416956 2014 A proteome-scale map of the human interactome network.
25196843 2014 Protein/protein interactions in the mammalian heme degradation pathway: heme oxygenase-2, cytochrome P450 reductase, and biliverdin reductase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222129 2013 Targeting biliverdin reductase overcomes multidrug resistance in leukemia HL60 cells.
24113378 2013 Biliverdin reductase plays a crucial role in hypoxia-induced chemoresistance in human glioblastoma.
24060811 2013 Activation of human biliverdin-IX? reductase by urea: generation of kinetically distinct forms during the unfolding pathway.
23536765 2013 Expression of Biliverdin Reductase A in peripheral blood leukocytes is associated with treatment response in HCV-infected patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...