Property Summary

NCBI Gene PubMed Count 145
Grant Count 600
R01 Count 273
Funding $170,197,983.81
PubMed Score 243.80
PubTator Score 418.29

Knowledge Summary

Patent

No data available

Synonym

Accession P52945 O60594 Q5VYW2 PDX-1
Symbols GSF
IPF1
IUF1
IDX-1
MODY4
PDX-1
STF-1
PAGEN1

Gene

 GO Component (2)

Gene RIF (123)

PMID Text
26727107 Foxo1 and PDX1 are colocalized in fetal pancreatic islets, suggesting they function in parallel in beta cells.
26695692 The ERK-PDX-1 interaction in PANC-1 cells.
26345820 This study investigated the role of Pdx1 and its mechanism in differentiating induced pluripotent stem cells (iPSCs) into islet beta cells.
26252949 the human Pdx1 is highly effective in triggering human biliary tree stem cells differentiation toward functional beta-pancreatic cells.
26058934 The rs12255372 SNP of TCF7L2 and D76N of PDX-1 genes may confer susceptibility to T2DM in the population living in Mashhad, Iran.
25843046 we found that PDX1 binds and suppresses expression of endogenous liver genes. These findings rebrand PDX1 as a context-dependent transcriptional repressor and activator within the same cell type.
25839229 These results suggest that IFN-gamma induced beta-cell dysfunction is mediated through decreased nuclear localization of Pdx-1.
25817342 Introduction of the PDX1 gene makes cells acquire a functional insulin secretory capacity
25801033 physiological and pathophysiological conditions dynamically regulated Pdx1 binding to these Swi/Snf complexes in vivo
25454709 PDX-1mRNA is detectable in samples of pancreatic cancer. Its quantification may be helpful to improve the diagnosis of pancreatic cancer.
More...

AA Sequence

MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEV      1 - 70
PPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYA     71 - 140
AEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRG    141 - 210
GGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ    211 - 280
EPR                                                                       281 - 283
//

Text Mined References (146)

PMID Year Title
26727107 2016 FoxO1 Plays an Important Role in Regulating ?-Cell Compensation for Insulin Resistance in Male Mice.
26695692 2016 Metformin Restrains Pancreatic Duodenal Homeobox-1 (PDX-1) Function by Inhibiting ERK Signaling in Pancreatic Ductal Adenocarcinoma.
26345820 2015 Pdxl and its role in activating Ngn3 and Pax6 to induce differentiation of iPSCs into islet ? cells.
26252949 2015 Adult Human Biliary Tree Stem Cells Differentiate to ?-Pancreatic Islet Cells by Treatment with a Recombinant Human Pdx1 Peptide.
26058934 2015 Association of rs12255372 (TCF7L2) and D76N (PDX-1) Polymorphisms with Type 2 Diabetes in a Population Living in Northeast Iran.
25843046 2015 PDX1 binds and represses hepatic genes to ensure robust pancreatic commitment in differentiating human embryonic stem cells.
25839229 2015 Interferon-? Decreases Nuclear Localization of Pdx-1 and Triggers ?-Cell Dysfunction in Chronic Pancreatitis.
25817342 2015 Forced expression of PDX-1 gene makes hepatoma cells to acquire glucose-responsive insulin secretion while maintaining hepatic characteristic.
25801033 2015 Dynamic recruitment of functionally distinct Swi/Snf chromatin remodeling complexes modulates Pdx1 activity in islet ? cells.
25454709 2015 PDX-1 mRNA expression in endoscopic ultrasound-guided fine needle cytoaspirate: perspectives in the diagnosis of pancreatic cancer.
More...