Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.42
PubTator Score 93.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
diabetes mellitus -1.100 1.3e-03
Duchenne muscular dystrophy 1.076 3.4e-11
ependymoma 1.400 9.7e-03
esophageal adenocarcinoma -1.400 2.1e-02
intraductal papillary-mucinous carcinoma... -1.200 2.0e-03
invasive ductal carcinoma 1.200 1.1e-02
malignant mesothelioma 1.600 1.5e-06
non-small cell lung cancer -1.427 3.2e-10
ovarian cancer 1.100 1.5e-04
Polycystic ovary syndrome -1.004 1.6e-02
sonic hedgehog group medulloblastoma 1.600 5.4e-04
ulcerative colitis 1.200 1.1e-04

Gene RIF (5)

AA Sequence

MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG      1 - 70
GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT     71 - 140
SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP      141 - 208
//

Text Mined References (25)

PMID Year Title