Property Summary

NCBI Gene PubMed Count 16
Grant Count 26
R01 Count 18
Funding $1,312,556.55
PubMed Score 10.42
PubTator Score 93.39

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
22154084 CRIP2 expression is down-regulated in ESCC tissues and cell lines.
21540330 CRIP2 acts as a transcription repressor of the NF-kappaB-mediated proangiogenic cytokine expression and thus functionally inhibits tumor formation and angiogenesis
20460109 These findings suggest that ADAM19 autolysis is activated by lipopolysaccharide and that ADAM19 promotes the secretion of CRIP2.
12530967 Function of avian CRIP2 in smooth muscle differentiation

AA Sequence

MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG      1 - 70
GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT     71 - 140
SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP      141 - 208
//

Text Mined References (24)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22154084 2012 The LIM domain protein, CRIP2, promotes apoptosis in esophageal squamous cell carcinoma.
21540330 2011 Cysteine-rich intestinal protein 2 (CRIP2) acts as a repressor of NF-kappaB-mediated proangiogenic cytokine transcription to suppress tumorigenesis and angiogenesis.
21269460 2011 Initial characterization of the human central proteome.
20667089 2010 Transcriptome analysis of human cancer reveals a functional role of heme oxygenase-1 in tumor cell adhesion.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20460109 2010 ADAM19 autolysis is activated by LPS and promotes non-classical secretion of cysteine-rich protein 2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...