Property Summary

NCBI Gene PubMed Count 313
PubMed Score 1794.10
PubTator Score 505.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cancer 2499 4.965 2.5

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.919 3.2e-02
adult high grade glioma 1.400 4.3e-04
Astrocytoma, Pilocytic 2.400 1.6e-05
atypical teratoid / rhabdoid tumor 1.400 6.7e-03
cutaneous lupus erythematosus 2.100 2.8e-02
cystic fibrosis 3.700 1.4e-04
ependymoma 1.100 1.2e-03
glioblastoma 2.400 8.0e-05
interstitial cystitis 1.500 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.5e-03
lung adenocarcinoma 1.100 2.0e-02
lung cancer 1.100 2.4e-02
malignant mesothelioma -6.100 4.2e-09
medulloblastoma, large-cell 1.800 5.8e-03
non-small cell lung cancer 2.986 1.9e-12
ovarian cancer 2.700 1.4e-04
pancreatic cancer 1.400 2.0e-03
pituitary cancer 2.300 1.8e-03
primitive neuroectodermal tumor 4.000 6.7e-03
psoriasis 1.400 8.9e-15
ulcerative colitis -1.900 1.7e-09

Gene RIF (268)

AA Sequence

MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA      1 - 70
TGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED                                    71 - 109
//

Text Mined References (317)

PMID Year Title