Property Summary

NCBI Gene PubMed Count 268
Grant Count 126
R01 Count 72
Funding $14,379,814.39
PubMed Score 1667.74
PubTator Score 505.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52926 E7EP85 E7EWA2 Q1M182 Q1M185 Q1M186 Q1M187 Q1M188
Symbols BABL
LIPO
HMGIC
HMGI-C
STQTL9

Gene

Gene RIF (223)

PMID Text
26858029 the expression of MYCN, HMGA2, and DICER1 seems to be correlated to each other and the expression of the let7-genes impacted by their expression.
26857357 Case Report: Fusion of the HMGA2 and C9orf92 genes in myolipoma with t(9;12)(p22;q14).
26818837 HMGA2 promotes tongue squamous cell carcinoma invasion and metastasis.
26646104 miR-23b acts as a suppressor of epithelial-to-mesenchymal transition in diabetic nephropathy through repressing PI3K-AKT signaling pathway by targeting HMGA2 and thus alleviating the disease.
26608380 We identified a novel DNA rearrangement upstream of HMGA2 that had gone undetected in an earlier whole-genome sequencing study.
26406941 MiR-204 was downregulated in the thyroid cancer specimens and cell lines, and targeted the 3'prime untranslated region of HMGA2 directly.
26341146 Results suggest that microRNA miR-490-3p functions as a potential tumor suppressor by down-regulating high-mobility group protein HMGA2 expression directly.
26336885 amplification of HMGA2 was associated with the atypical lipomatous tumor/well-differentiated liposarcoma histological type and a good prognosis, whereas CDK4 and JUN amplifications were associated with dedifferentiated liposarcoma histology
26319392 HMGA2 is predominantly amplified and expressed in AML cells, and that aberrant expression of HMGA2 induces AML cell proliferation through the PI3K/Akt/mTOR signaling pathway.
26240284 HMGA2 loss results in enrichment of the transcriptional repressor E4F at the cyclin A2 promoter.
More...

AA Sequence

MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA      1 - 70
TGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED                                    71 - 109
//

Text Mined References (272)

PMID Year Title
26858029 2016 The MYCN-HMGA2-CDKN2A pathway in non-small cell lung carcinoma--differences in histological subtypes.
26857357 2016 Fusion of the HMGA2 and C9orf92 genes in myolipoma with t(9;12)(p22;q14).
26818837 2016 Overexpression of HMGA2 promotes tongue cancer metastasis through EMT pathway.
26646104 2016 Effects and mechanism of miR-23b on glucose-mediated epithelial-to-mesenchymal transition in diabetic nephropathy.
26608380 2016 Detection and screening of chromosomal rearrangements in uterine leiomyomas by long-distance inverse PCR.
26406941 2015 MiR-204 regulates HMGA2 expression and inhibits cell proliferation in human thyroid cancer.
26341146 2015 MicroRNA-490-3p regulates cell proliferation and apoptosis by targeting HMGA2 in osteosarcoma.
26336885 2015 Prognostic value of HMGA2, CDK4, and JUN amplification in well-differentiated and dedifferentiated liposarcomas.
26319392 2016 Amplified HMGA2 promotes cell growth by regulating Akt pathway in AML.
26240284 2015 Histone Deacetylase 10 Regulates the Cell Cycle G2/M Phase Transition via a Novel Let-7-HMGA2-Cyclin A2 Pathway.
More...