Property Summary

NCBI Gene PubMed Count 34
PubMed Score 20.07
PubTator Score 13.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Protein-protein Interaction (8)

Gene RIF (9)

PMID Text
26764407 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ alpha-1) and profilin 2.
26566078 mDia1 displaced from the barbed end by CapZ Actin Capping Protein can randomly slide along the actin filament and later return.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) expression by HIV-1 Vpr in Vpr transduced macrophages
23545944 The present study suggests that CAPZA1 could be a marker of good prognosis in gastric cancer and shows that CAPZA1 is associated with decreased cancer cell migration and invasion.
21566537 CAPAZA1 is over expressed in malignant melanoma.
18321953 Damaging exercise induced the expression of capZalpha, MCIP1, CARP1, DNAJB2, c-myc, and junD, each of which are likely involved in skeletal muscle growth, remodeling, and stress management.
16987810 CKIP-1 has a role in cell morphology that depends on its interaction with actin-capping protein
12690097 Cd2 antigen is linked to this protein via CMS and CIN85.
12488317 V-1, a protein expressed transiently during murine cerebellar development, regulates actin polymerization via interaction with capping protein

AA Sequence

MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY      1 - 70
EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF     71 - 140
CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK    141 - 210
DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG    211 - 280
KEMQNA                                                                    281 - 286
//

Text Mined References (41)

PMID Year Title
26764407 2016 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ ?-1) and profilin 2.
26566078 2015 Single-molecule visualization of a formin-capping protein 'decision complex' at the actin filament barbed end.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24951542 2014 A missense mutation in the PISA domain of HsSAS-6 causes autosomal recessive primary microcephaly in a large consanguineous Pakistani family.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23545944 2013 Prognostic value of CAPZA1 overexpression in gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178720 2013 Dab1 stabilizes its interaction with Cin85 by suppressing Cin85 phosphorylation at serine 587.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21566537 2011 Differential expression patterns of capping protein, protein phosphatase 1, and casein kinase 1 may serve as diagnostic markers for malignant melanoma.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19922875 2009 The Arp2/3 activator WASH controls the fission of endosomes through a large multiprotein complex.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18321953 2008 Gene expression profiling in human skeletal muscle during recovery from eccentric exercise.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16987810 2006 The role of CKIP-1 in cell morphology depends on its interaction with actin-capping protein.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16054028 2005 Mammalian CARMIL inhibits actin filament capping by capping protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690097 2003 Linking the T cell surface protein CD2 to the actin-capping protein CAPZ via CMS and CIN85.
12488317 2003 V-1, a protein expressed transiently during murine cerebellar development, regulates actin polymerization via interaction with capping protein.
12480931 2003 A novel S100 target conformation is revealed by the solution structure of the Ca2+-S100B-TRTK-12 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470955 2002 Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
9803314 1998 Hydrophobic residues in the C-terminal region of S100A1 are essential for target protein binding but not for dimerization.
9354614 1997 Purification and characterization of an alpha 1 beta 2 isoform of CapZ from human erythrocytes: cytosolic location and inability to bind to Mg2+ ghosts suggest that erythrocyte actin filaments are capped by adducin.
9331217 1997 Vertebrates have conserved capping protein alpha isoforms with specific expression patterns.
9119363 1997 Mapping of the mouse actin capping protein alpha subunit genes and pseudogenes.
8639502 1996 Purification and properties of a Ca(2+)-independent barbed-end actin filament capping protein, CapZ, from human polymorphonuclear leukocytes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7665558 1995 Sequence analysis and chromosomal localization of human Cap Z. Conserved residues within the actin-binding domain may link Cap Z to gelsolin/severin and profilin protein families.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.