Property Summary

NCBI Gene PubMed Count 34
PubMed Score 20.07
PubTator Score 13.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52907 Q53FQ6 Q6FHD5
Symbols CAPZ
CAZ1
CAPPA1

Gene

PDB

1MQ1   1MWN  

Gene RIF (9)

PMID Text
26764407 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ alpha-1) and profilin 2.
26566078 mDia1 displaced from the barbed end by CapZ Actin Capping Protein can randomly slide along the actin filament and later return.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) expression by HIV-1 Vpr in Vpr transduced macrophages
23545944 The present study suggests that CAPZA1 could be a marker of good prognosis in gastric cancer and shows that CAPZA1 is associated with decreased cancer cell migration and invasion.
21566537 CAPAZA1 is over expressed in malignant melanoma.
18321953 Damaging exercise induced the expression of capZalpha, MCIP1, CARP1, DNAJB2, c-myc, and junD, each of which are likely involved in skeletal muscle growth, remodeling, and stress management.
16987810 CKIP-1 has a role in cell morphology that depends on its interaction with actin-capping protein
12690097 Cd2 antigen is linked to this protein via CMS and CIN85.
12488317 V-1, a protein expressed transiently during murine cerebellar development, regulates actin polymerization via interaction with capping protein

AA Sequence

MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY      1 - 70
EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF     71 - 140
CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK    141 - 210
DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG    211 - 280
KEMQNA                                                                    281 - 286
//

Text Mined References (41)

PMID Year Title
26764407 2016 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ ?-1) and profilin 2.
26566078 2015 Single-molecule visualization of a formin-capping protein 'decision complex' at the actin filament barbed end.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24951542 2014 A missense mutation in the PISA domain of HsSAS-6 causes autosomal recessive primary microcephaly in a large consanguineous Pakistani family.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23545944 2013 Prognostic value of CAPZA1 overexpression in gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...