Property Summary

NCBI Gene PubMed Count 62
Grant Count 37
R01 Count 23
Funding $4,383,104.89
PubMed Score 410.81
PubTator Score 154.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.051 0.000

 GO Component (1)

Gene RIF (42)

PMID Text
26351209 Identify two novel factors, AKR1C2 (positive factor) and NF1 (negative factor), as the AEG-1 downstream players in the process of metastasis in liver cancer.
26318406 We identified two powerful genes in the liver cancer metastasis process, AEG-1 and AKR1C2.
26244607 The endogenous HMOX1 gene but not the AKR1C2 gene is strongly repressed by Bach1 in HaCaT keratinocytes.
25463305 In model cell lines of endometrial cancer, AKR1C2 and SRD5A1 have crucial roles in progesterone metabolism.
24434280 The V54L mutation significantly decreases the 3alpha-hydroxysteroid dehydrogenase activity of DDH2 for the reduction of dihydrotestosterone.
24244276 Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue
22534668 DDH2 expression might be a potential predictor and monitor of cisplatin efficacy in advanced NSCLC patients.
22275760 Data suggest that modulation of AKR1C2 by glucocorticoids (dexamethasone in this study) locally modifies exposure of adipose cells to endogenous androgens; thus, AKR1C2 activation/inactivation may be involved in regional fat deposition.
22064385 Data suggest that interleukin-1beta facilitates progesterone metabolism in cervical fibroblasts by regulating expression of AKR1C1 and AKR1C2.
21521174 role of AKR1C2 in the metabolism of testosterone and progesterone via the 5beta-reductase pathway.
More...

AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD     71 - 140
TVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD    141 - 210
IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY                               281 - 323
//

Text Mined References (66)

PMID Year Title
26351209 2014 AEG-1 Promotes Metastasis Through Downstream AKR1C2 and NF1 in Liver Cancer.
26318406 2016 High-Content Functional Screening of AEG-1 and AKR1C2 for the Promotion of Metastasis in Liver Cancer.
26244607 2015 Dual regulation of skin sensitizer-induced HMOX1 expression by Bach1 and Nrf2: Comparison to regulation of the AKR1C2-ARE element in the KeratinoSens cell line.
25463305 2015 Important roles of the AKR1C2 and SRD5A1 enzymes in progesterone metabolism in endometrial cancer model cell lines.
24434280 2014 Human 3-alpha hydroxysteroid dehydrogenase type 3 (3?-HSD3): the V54L mutation restricting the steroid alternative binding and enhancing the 20?-HSD activity.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
22534668 2012 Proteomics-based identification of secreted protein dihydrodiol dehydrogenase 2 as a potential biomarker for predicting cisplatin efficacy in advanced NSCLC patients.
22275760 2012 Glucocorticoid-induced androgen inactivation by aldo-keto reductase 1C2 promotes adipogenesis in human preadipocytes.
22064385 2012 Interleukin 1? regulates progesterone metabolism in human cervical fibroblasts.
21851338 2011 Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.
More...