Property Summary

NCBI Gene PubMed Count 31
Grant Count 41
R01 Count 23
Funding $3,482,517.59
PubMed Score 139.24
PubTator Score 37.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.158 0.007

Gene RIF (13)

PMID Text
25180910 THOP1 may have clinical potentials to be employed as a promising biomarker to identify individuals with better prognosis and a novel antitumor agent for therapy of patients with NSCLC
24604581 Low THOP1 expression levels are associated with recurrence of hepatocellular carcinoma.
24223886 TCEP. Data indicate that THIMET-oligopeptidase (TOP) oxidation by H2O2 and high valence states of hemeproteins does not lead to enzyme oligomerization.
23708739 shear-dependent TOP induction down-regulates MHC1 levels, pointing to a role for TOP in the flow-mediated regulation of endothelial immunogenicity
22796113 The semi-quantitative intracellular peptidome analyses of siRNA-transfected HEK293 cells shows that the levels of specific intracellular peptides are either increased or decreased upon EP24.15 inhibition.
21151101 mediates antigen processing that generates cytotoxic T cell epitopes
19614740 interaction between EP24.15 and calmodulin is regulated within cells and is important for the stimulated secretion of EP24.15 from HEK293 cells.
19282285 Over 100 peptides were identified in human embryonic kidney 293 (HEK293) cells that are derived from intracellular proteins; many but not all of these peptides are substrates or products of EP24.15.
18571100 increase in THOP1 expression might be part of a compensatory defense mechanism of the brain against an increased Abeta load.
17251185 Mutations at only two residues (Glu-469 and Arg-498) are required to swap specificity with neurolysin, a result that is confirmed by testing the two-mutant constructs.
More...

AA Sequence

MKPPAACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKALAD      1 - 70
VEVTYTVQRNILDFPQHVSPSKDIRTASTEADKKLSEFDVEMSMREDVYQRIVWLQEKVQKDSLRPEAAR     71 - 140
YLERLIKLGRRNGLHLPRETQENIKRIKKKLSLLCIDFNKNLNEDTTFLPFTLQELGGLPEDFLNSLEKM    141 - 210
EDGKLKVTLKYPHYFPLLKKCHVPETRRKVEEAFNCRCKEENCAILKELVTLRAQKSRLLGFHTHADYVL    211 - 280
EMNMAKTSQTVATFLDELAQKLKPLGEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQVEETRYC    281 - 350
VDQNLLKEYFPVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREG    351 - 420
KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADAPSLLQHDEVETYFHEFGHVMHQLCSQAEFAM    421 - 490
FSGTHVERDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAVPRELLEKLIESRQANTGLFNLRQIVLAKV    491 - 560
DQALHTQTDADPAEEYARLCQEILGVPATPGTNMPATFGHLAGGYDAQYYGYLWSEVYSMDMFHTRFKQE    561 - 630
GVLNSKVGMDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQVC               631 - 689
//

Text Mined References (36)

PMID Year Title
25180910 2014 Expression of THOP1 and its relationship to prognosis in non-small cell lung cancer.
24604581 2014 Expression analysis of THOP1 in background liver, a prognostic predictive factor in hepatocellular carcinoma, extracted by multiarray analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223886 2013 Recycling of the high valence States of heme proteins by cysteine residues of THIMET-oligopeptidase.
23708739 2013 Shear stress is a positive regulator of thimet oligopeptidase (EC3.4.24.15) in vascular endothelial cells: consequences for MHC1 levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22796113 2012 Inhibition of thimet oligopeptidase by siRNA alters specific intracellular peptides and potentiates isoproterenol signal transduction.
21269460 2011 Initial characterization of the human central proteome.
21151101 2011 Antigen processing by nardilysin and thimet oligopeptidase generates cytotoxic T cell epitopes.
More...