Property Summary

NCBI Gene PubMed Count 26
PubMed Score 84.71
PubTator Score 34.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.200 4.8e-20
lung carcinoma -1.300 5.2e-12
malignant mesothelioma 1.600 2.5e-07
medulloblastoma, large-cell -1.500 6.1e-05
psoriasis -1.700 9.9e-05

Gene RIF (15)

AA Sequence

MPALACLRRLCRHVSPQAVLFLLFIFCLFSVFISAYYLYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPL      1 - 70
KPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYEN     71 - 140
ILKYVNLDAWNRELLDKYCVAYGVGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVT    141 - 210
RPSEVEKGVLPGEDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVL    211 - 280
FGNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFDTQNELRAHIP    281 - 350
NFTFNLGYSGKFFHTGTNAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLFHNQSVLAEQMALNKKFAVEHG    351 - 420
IPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWSIRVTSTEEYPHLKPARYRRGFIHNGIMVLPRQTCGLFT    421 - 490
HTIFYNEYPGGSSELDKIINGGELFLTVLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQT    491 - 560
LPPVQLAQKYFQIFSEEKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDL    561 - 630
SSNYPSSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALLPKAKVL    631 - 700
TILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGSDASSKLRALQNRCLVPGWYATHIERWLSAYHA    701 - 770
NQILVLDGKLLRTEPAKVMDMVQKFLGVTNTIDYHKTLAFDPKKGFWCQLLEGGKTKCLGKSKGRKYPEM    771 - 840
DLDSRAFLKDYYRDHNIELSKLLYKMGQTLPTWLREDLQNTR                                841 - 882
//

Text Mined References (27)

PMID Year Title