Property Summary

NCBI Gene PubMed Count 25
PubMed Score 35.60
PubTator Score 19.87

Knowledge Summary

Patent (1,014)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 4.0e-05
glioblastoma -1.300 2.5e-05
group 4 medulloblastoma -1.800 1.6e-08
intraductal papillary-mucinous carcinoma... 2.000 2.8e-05
intraductal papillary-mucinous neoplasm ... 2.000 2.0e-03
juvenile dermatomyositis 1.182 1.3e-12
medulloblastoma, large-cell -2.400 9.1e-05
ovarian cancer 2.500 3.8e-09
Pick disease -1.800 1.6e-04
posterior fossa group B ependymoma -1.100 2.0e-10
ulcerative colitis -1.100 2.9e-04

Gene RIF (9)

AA Sequence

MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPGHSFRKVTLTK      1 - 70
PTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRK     71 - 140
VLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVL    141 - 210
AGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGS    211 - 280
AAVGPGRETQATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRL    281 - 350
PPSSQACDAWAGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPK    351 - 420
STARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVRQVSQTRFYVA    421 - 490
ESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLK    491 - 560
DMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGL    561 - 630
HLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSV    631 - 700
LLSVDEADAVLMDRWTILLDAHEAGSAENDTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFT    701 - 770
SRLHNKGVYVRVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKP    771 - 840
RMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKV    841 - 910
HMLRKAKQKPRRAGTTRDARADAAPAPESDPR                                          911 - 942
//

Text Mined References (29)

PMID Year Title