Property Summary

NCBI Gene PubMed Count 25
Grant Count 11
R01 Count 9
Funding $850,962.67
PubMed Score 34.15
PubTator Score 19.87

Knowledge Summary

Patent (1,014)

Expression

Gene RIF (9)

PMID Text
24369117 these data demonstrate that DGKtheta; plays an important role in steroid hormone production in human adrenocortical cells
23767959 Data suggest that diacylglycerol kinase theta is a key mediator of bile-acid-stimulated modulation of farnesoid X receptor/mTOR complex 2/Akt signaling pathway and glucose metabolism/homoeostasis in hepatocytes.
23618683 This study found that the minor alleles of GAK rs1564282 and DGKQ rs11248060 significantly increase the risk of PD in Han Chinese populations.
23610160 The SF1 and SREBP1 activate DGKtheta; transcription in a cAMP-dependent manner in human adrenocortical cells.
23091060 DGK-theta; directly interacts with, and is activated by, basic proteins such as histone H1 and Tau with nm affinity, consistent with a potential role for a polybasic protein or protein domain in the activation of this enzyme.
22732145 DGKtheta; translocation and activity is regulated by the concerted activity of EGFR and PKC.
17664281 Data show that cyclic AMP-stimulated interaction between steroidogenic factor 1 and diacylglycerol kinase theta facilitates induction of CYP17.
15632189 DGK interacts selectively with and is phosphorylated by PKCepsilon and -eta and peptide agonist-induced selective activation of PKCepsilon directly leads to DGK translocation
12799190 Nuclear DGK-theta co-localizes with phosphatidylinositol 4,5-bisphosphate (PIP(2)) in domains that correspond to nuclear speckles.

AA Sequence

MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPGHSFRKVTLTK      1 - 70
PTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRK     71 - 140
VLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVL    141 - 210
AGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGS    211 - 280
AAVGPGRETQATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRL    281 - 350
PPSSQACDAWAGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPK    351 - 420
STARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVRQVSQTRFYVA    421 - 490
ESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLK    491 - 560
DMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGL    561 - 630
HLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSV    631 - 700
LLSVDEADAVLMDRWTILLDAHEAGSAENDTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFT    701 - 770
SRLHNKGVYVRVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKP    771 - 840
RMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKV    841 - 910
HMLRKAKQKPRRAGTTRDARADAAPAPESDPR                                          911 - 942
//

Text Mined References (29)

PMID Year Title
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24369117 2014 Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells.
23767959 2013 Diacylglycerol kinase ? couples farnesoid X receptor-dependent bile acid signalling to Akt activation and glucose homoeostasis in hepatocytes.
23618683 2013 GAK rs1564282 and DGKQ rs11248060 increase the risk for Parkinson's disease in a Chinese population.
23610160 2013 cAMP-stimulated transcription of DGK? requires steroidogenic factor 1 and sterol regulatory element binding protein 1.
23091060 2012 Dual regulation of diacylglycerol kinase (DGK)-?: polybasic proteins promote activation by phospholipids and increase substrate affinity.
22732145 2012 Diacylglycerol kinase ? counteracts protein kinase C-mediated inactivation of the EGF receptor.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
22438815 2012 Comprehensive research synopsis and systematic meta-analyses in Parkinson's disease genetics: The PDGene database.
More...