Property Summary

NCBI Gene PubMed Count 93
PubMed Score 780.09
PubTator Score 255.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 2.812 1.2e-04
Barrett's esophagus 1.500 4.8e-02
Breast cancer -1.300 1.3e-02
cutaneous lupus erythematosus 1.100 1.7e-02
cystic fibrosis 4.114 1.7e-07
cystic fibrosis and chronic rhinosinusit... 1.457 2.0e-02
Endometriosis -1.922 2.1e-02
esophageal adenocarcinoma 1.300 2.1e-02
Gaucher disease type 3 -3.000 1.9e-02
glioblastoma multiforme 1.100 6.5e-06
head and neck cancer 1.500 1.4e-03
interstitial lung disease -2.400 2.5e-02
intraductal papillary-mucinous adenoma (... -3.100 5.3e-05
intraductal papillary-mucinous neoplasm ... -2.300 4.2e-03
lung cancer -1.500 1.1e-03
malignant mesothelioma -5.800 3.6e-09
osteosarcoma 1.955 2.0e-03
ovarian cancer 2.000 9.1e-05
pancreatic cancer 1.200 1.4e-02
pituitary cancer -2.700 5.5e-05
primary pancreatic ductal adenocarcinoma 1.419 1.9e-02
psoriasis -2.800 1.4e-04
subependymal giant cell astrocytoma 1.219 4.6e-02
ulcerative colitis 2.600 1.8e-04

 GO Function (1)

Gene RIF (76)

AA Sequence

MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGM      1 - 70
YDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKR     71 - 140
NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRAD    141 - 210
FNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA                                     211 - 247
//

Text Mined References (95)

PMID Year Title