Property Summary

NCBI Gene PubMed Count 79
Grant Count 91
R01 Count 56
Funding $20,375,485.46
PubMed Score 730.37
PubTator Score 255.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52823 B4DN22 Q71UE5 STC-1
Symbols STC

Gene

PANTHER Protein Class (2)

Gene RIF (62)

PMID Text
26640170 STC1 blunts bleomycin-induced rise in thrombin protein and activity, diminishes thrombin-induced signaling through PAR1 to ERK, and inhibits bleomycin-induced pneumonitis.
26531219 Data revealed the existence of a moderating effect between Klotho and STC1, where Klotho may inhibit thyroid tumor progression by inhibiting the tumor marker level of STC1.
26469082 High expression levels of stanniocalcin-1 is associated with Hepatocellular Carcinoma.
26195635 Data show that co-transfection with cDNA encoding stanniocalcin-1 abrogates the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) toward IGF-binding protein 4 (IGFBP-4).
26187698 Results show that STC1 have an important role in the carbohydrate metabolism regulation, in particular gluconeogenesis from glutamine in the kidney, across the vertebrates.
25783529 These results suggested that STC1 may be a valuable biomarker in diagnosing malignant degree of glioma and evaluating prognostic following surgery
25740019 These findings demonstrate a role for STC1 in metastasis of early stage clear cell renal cell carcinoma.
25647164 Stanniocalcin 1 is expressed in thyroid side population cells and thyroid cancer cells.
25591908 STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition.
25391215 This is the first study to show definitively that STC1 plays an oncogenic role in breast cancer, and indicates that STC1 could be a potential therapeutic target for treatment of breast cancer patients.
More...

AA Sequence

MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGM      1 - 70
YDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKR     71 - 140
NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRAD    141 - 210
FNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA                                     211 - 247
//

Text Mined References (81)

PMID Year Title
26640170 2015 Stanniocalcin-1 inhibits thrombin-induced signaling and protects from bleomycin-induced lung injury.
26531219 2016 Klotho inhibits human follicular thyroid cancer cell growth and promotes apoptosis through regulation of the expression of stanniocalcin-1.
26469082 2015 Stanniocalcin-1 Reduces Tumor Size in Human Hepatocellular Carcinoma.
26195635 2015 Stanniocalcin-1 Potently Inhibits the Proteolytic Activity of the Metalloproteinase Pregnancy-associated Plasma Protein-A.
26187698 2015 Stanniocalcin 1 effects on the renal gluconeogenesis pathway in rat and fish.
25783529 2015 Stanniocalcin-1, a new biomarker of glioma progression, is associated with prognosis of patients.
25740019 2015 Hypoxia-induced overexpression of stanniocalcin-1 is associated with the metastasis of early stage clear cell renal cell carcinoma.
25647164 2015 Expression of stanniocalcin 1 in thyroid side population cells and thyroid cancer cells.
25591908 2015 STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition.
25391215 2015 STC1 expression is associated with tumor growth and metastasis in breast cancer.
More...