Property Summary

NCBI Gene PubMed Count 79
PubMed Score 730.37
PubTator Score 255.89

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 3.56707510446506E-9
cystic fibrosis 1670 1.65568299825063E-7
glioblastoma multiforme 347 6.53016802001095E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 5.28246838060151E-5
pituitary cancer 1972 5.48530689798708E-5
ovarian cancer 8492 9.14626827821629E-5
adrenocortical carcinoma 1427 1.1894411916037E-4
psoriasis 6685 1.41453832441059E-4
ulcerative colitis 2087 2.76270062462548E-4
lung cancer 4473 0.00112509048726505
osteosarcoma 7933 0.00200907506424086
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00420183068612017
Breast cancer 3099 0.0134083424535865
pancreatic cancer 2300 0.0136568464802845
head and neck cancer 270 0.0140298468989709
cutaneous lupus erythematosus 1056 0.017105873660174
Gaucher disease type 3 76 0.0189371540648303
primary pancreatic ductal adenocarcinoma 1271 0.0191819810615278
Barrett's esophagus 185 0.0204780914483485
Endometriosis 535 0.0211692173305316
esophageal adenocarcinoma 737 0.0214020317316477
interstitial lung disease 292 0.0251919702077433
subependymal giant cell astrocytoma 2287 0.0464475879025949
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Gout 93 0.0 2.0
Kidney disease 397 0.0 2.0



Accession P52823 B4DN22 Q71UE5 STC-1
Symbols STC


PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (62)

26640170 STC1 blunts bleomycin-induced rise in thrombin protein and activity, diminishes thrombin-induced signaling through PAR1 to ERK, and inhibits bleomycin-induced pneumonitis.
26531219 Data revealed the existence of a moderating effect between Klotho and STC1, where Klotho may inhibit thyroid tumor progression by inhibiting the tumor marker level of STC1.
26469082 High expression levels of stanniocalcin-1 is associated with Hepatocellular Carcinoma.
26195635 Data show that co-transfection with cDNA encoding stanniocalcin-1 abrogates the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) toward IGF-binding protein 4 (IGFBP-4).
26187698 Results show that STC1 have an important role in the carbohydrate metabolism regulation, in particular gluconeogenesis from glutamine in the kidney, across the vertebrates.
25783529 These results suggested that STC1 may be a valuable biomarker in diagnosing malignant degree of glioma and evaluating prognostic following surgery
25740019 These findings demonstrate a role for STC1 in metastasis of early stage clear cell renal cell carcinoma.
25647164 Stanniocalcin 1 is expressed in thyroid side population cells and thyroid cancer cells.
25591908 STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition.
25391215 This is the first study to show definitively that STC1 plays an oncogenic role in breast cancer, and indicates that STC1 could be a potential therapeutic target for treatment of breast cancer patients.

AA Sequence

FNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA                                     211 - 247

Text Mined References (81)

PMID Year Title
26640170 2015 Stanniocalcin-1 inhibits thrombin-induced signaling and protects from bleomycin-induced lung injury.
26531219 2016 Klotho inhibits human follicular thyroid cancer cell growth and promotes apoptosis through regulation of the expression of stanniocalcin-1.
26469082 2015 Stanniocalcin-1 Reduces Tumor Size in Human Hepatocellular Carcinoma.
26195635 2015 Stanniocalcin-1 Potently Inhibits the Proteolytic Activity of the Metalloproteinase Pregnancy-associated Plasma Protein-A.
26187698 2015 Stanniocalcin 1 effects on the renal gluconeogenesis pathway in rat and fish.
25783529 2015 Stanniocalcin-1, a new biomarker of glioma progression, is associated with prognosis of patients.
25740019 2015 Hypoxia-induced overexpression of stanniocalcin-1 is associated with the metastasis of early stage clear cell renal cell carcinoma.
25647164 2015 Expression of stanniocalcin 1 in thyroid side population cells and thyroid cancer cells.
25591908 2015 STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition.
25391215 2015 STC1 expression is associated with tumor growth and metastasis in breast cancer.