Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.20
PubTator Score 8.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count Z-score Confidence
Brain glioma 7 3.07 1.5

Expression

Gene RIF (4)

AA Sequence

MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQD      1 - 70
IASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPV     71 - 140
DKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE                141 - 198
//

Text Mined References (21)

PMID Year Title