Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.20
PubTator Score 8.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Brain glioma 10 3.115 1.6

Expression

Synonym

Accession P52815 Q969U0 Q9HCA2 Q9UQJ3 L12mt
Symbols 5c5-2
L12mt
MRPL7
RPML12
MRPL7/L12
MRP-L31/34

Gene

  Ortholog (7)

Species Source
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Horse EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (4)

PMID Text
26586915 knock-down of MRPL12 by RNA interference results in instability of POLRMT.
23603806 This mutation resulted in a decreased steady-state level of MRPL12 protein.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17337445 the MRPL12 interaction with POLRMT is likely part of a novel regulatory mechanism that coordinates mitochondrial transcription with translation

AA Sequence

MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQD      1 - 70
IASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPV     71 - 140
DKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE                141 - 198
//

Text Mined References (19)

PMID Year Title
26586915 2016 Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23603806 2013 Mutations in mitochondrial ribosomal protein MRPL12 leads to growth retardation, neurological deterioration and mitochondrial translation deficiency.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20186120 2010 A functional peptidyl-tRNA hydrolase, ICT1, has been recruited into the human mitochondrial ribosome.
19103604 2009 hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.
17337445 2007 Human mitochondrial ribosomal protein MRPL12 interacts directly with mitochondrial RNA polymerase to modulate mitochondrial gene expression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...