Property Summary

NCBI Gene PubMed Count 51
PubMed Score 355.60
PubTator Score 194.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -2.200 4.4e-04
astrocytic glioma -1.800 9.2e-03
Astrocytoma, Pilocytic -1.200 1.1e-04
atypical teratoid / rhabdoid tumor -1.800 1.7e-03
Breast cancer -2.200 2.4e-10
breast carcinoma -1.100 1.4e-16
cutaneous lupus erythematosus -1.200 5.2e-03
cystic fibrosis 1.244 4.3e-04
gastric cancer 1.400 1.4e-03
glioblastoma -2.200 1.8e-06
group 4 medulloblastoma -1.100 1.8e-03
interstitial cystitis -1.500 7.3e-04
intraductal papillary-mucinous adenoma (... 2.000 9.6e-04
intraductal papillary-mucinous carcinoma... 2.000 1.4e-03
intraductal papillary-mucinous neoplasm ... 2.400 6.2e-03
lung adenocarcinoma 1.200 4.8e-05
lung cancer -1.700 6.7e-05
lung carcinoma -2.100 1.7e-28
malignant mesothelioma 1.200 1.5e-06
medulloblastoma, large-cell -2.100 6.5e-05
oligodendroglioma -1.600 1.6e-02
ovarian cancer -1.400 2.3e-07
pancreatic cancer 1.800 1.8e-07
psoriasis -2.300 2.3e-05

Gene RIF (18)

AA Sequence

MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP      1 - 70
EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYIS     71 - 140
SAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRI    141 - 210
PSRLLAILLFLLAMLLTL                                                        211 - 228
//

Text Mined References (52)

PMID Year Title