Property Summary

NCBI Gene PubMed Count 46
Grant Count 98
R01 Count 58
Funding $11,027,654.01
PubMed Score 342.09
PubTator Score 194.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession P52803
Symbols AF1
EFL5
RAGS
EPLG7
GLC1M
LERK7

Gene

PDB

4BK5   4BKA   4M4R   2X11   3MX0   4L0P  

Gene RIF (17)

PMID Text
25993310 the structure of the ligand-binding domain of the EphA3 receptor in complex with its preferred ligand, ephrin-A5, is reported.
25663355 MiR-96 and miR-182 are upregulated in hepatocellular carcinoma and negatively associated with ephrin A5 expression.
25300504 The genetic variations c.668C>T (rs201008479), c.102C>T (rs199980747) and c.-27C>G (rs200187971) may present an additional genetic risk factor for age-related cataract in the Chinese population.
23959867 Data indicate that ephrin-A5 binding directly facilitates the formation of Eph/ephrin clusters by inducing conformational changes in the ligand-binding domain (LBD) of EphA4.
23401654 Transgenic ephrin-A5 plays a critical role in postnatal lens fiber organization to maintain lens transparency: cells in the ephrin-A5-deficient lens are severely disorganized
22860012 EphrinA5, especially ephrinA5S, acts as a tumor suppressor in hepatocarcinogenesis.
22074469 Data suggest that ephrinA5 mRNA/protein levels are reduced in colon adenocarcinoma compared to normal colon tissue; staging/grading indicates that ephrinA5 inhibits colon adenocarcinoma progression via c-Cbl-mediated EGFR ubiquitination/degradation.
22072270 This study presented that EFNA5 showed strong associations with alcohol withdrawal symptoms.
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP      1 - 70
EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYIS     71 - 140
SAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRI    141 - 210
PSRLLAILLFLLAMLLTL                                                        211 - 228
//

Text Mined References (47)

PMID Year Title
25993310 2015 Distinctive Structure of the EphA3/Ephrin-A5 Complex Reveals a Dual Mode of Eph Receptor Interaction for Ephrin-A5.
25663355 2016 OncomiR miR-96 and miR-182 promote cell proliferation and invasion through targeting ephrinA5 in hepatocellular carcinoma.
25300504 2014 Mutational screening of EFNA5 in Chinese age-related cataract patients.
23959867 2013 Insights into Eph receptor tyrosine kinase activation from crystal structures of the EphA4 ectodomain and its complex with ephrin-A5.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
23401654 2013 Further analysis of the lens of ephrin-A5-/- mice: development of postnatal defects.
23242526 2013 The ephrin signaling pathway regulates morphology and adhesion of mouse granulosa cells in vitro.
22860012 2012 Peritumoral small ephrinA5 isoform level predicts the postoperative survival in hepatocellular carcinoma.
22074469 2012 EphrinA5 suppresses colon cancer development by negatively regulating epidermal growth factor receptor stability.
22072270 2012 Genome-wide association study identifies 5q21 and 9p24.1 (KDM4C) loci associated with alcohol withdrawal symptoms.
More...