Property Summary

NCBI Gene PubMed Count 121
PubMed Score 288.95
PubTator Score 192.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
aldosterone-producing adenoma -1.045 4.0e-02
astrocytic glioma -2.000 3.6e-03
Barrett's esophagus 1.700 7.2e-03
Breast cancer 1.200 2.4e-02
breast carcinoma -1.100 2.7e-14
cystic fibrosis -1.531 3.1e-06
esophageal adenocarcinoma 1.600 2.5e-02
group 3 medulloblastoma -1.600 9.8e-03
intraductal papillary-mucinous adenoma (... 2.500 3.5e-03
intraductal papillary-mucinous carcinoma... 2.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.7e-02
lung adenocarcinoma -1.400 1.9e-12
lung cancer -1.900 2.1e-04
lung carcinoma -1.500 2.7e-07
malignant mesothelioma -1.800 1.2e-07
mucosa-associated lymphoid tissue lympho... 1.230 3.0e-02
nephrosclerosis 1.022 2.8e-04
non-small cell lung carcinoma -1.100 7.7e-13
oligodendroglioma -2.000 3.2e-02
ovarian cancer 1.900 5.9e-03
pancreatic cancer 1.900 2.2e-05
pancreatic ductal adenocarcinoma liver m... 1.646 1.8e-02
Pick disease 1.500 6.7e-06
psoriasis -1.500 6.8e-07
spina bifida -2.139 5.0e-02

 GWAS Trait (1)

Gene RIF (85)

AA Sequence

MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTV      1 - 70
GQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNG     71 - 140
SLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDG    141 - 210
NSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGN    211 - 280
NNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV                     281 - 333
//

Text Mined References (124)

PMID Year Title