Property Summary

NCBI Gene PubMed Count 104
PubMed Score 268.00
PubTator Score 192.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.67137280961322E-14
non-small cell lung carcinoma 413 7.71517348488064E-13
lung adenocarcinoma 2714 1.90429241030789E-12
psoriasis 6685 4.4834849172133E-12
malignant mesothelioma 3163 1.2354346382728E-7
lung carcinoma 2844 2.68879323563754E-7
group 4 medulloblastoma 1875 3.02245028773586E-7
cystic fibrosis 1670 3.08936295377621E-6
Pick disease 1893 6.70691787018162E-6
lung cancer 4473 2.05728816217781E-4
nephrosclerosis 329 2.82423253646245E-4
Breast cancer 3099 6.04713118857138E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.93516212816646E-4
astrocytic glioma 2241 0.00362003723932434
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00538376064101499
ovarian cancer 8492 0.00586074933058532
Barrett's esophagus 185 0.00716855294636028
pancreatic cancer 2300 0.013342616638065
primary pancreatic ductal adenocarcinoma 1271 0.0148350873094011
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0168004476706
esophageal adenocarcinoma 737 0.0248507761534546
mucosa-associated lymphoid tissue lymphoma 480 0.029782208056552
oligodendroglioma 2849 0.0322144535017098
aldosterone-producing adenoma 664 0.039503014345027
spina bifida 1064 0.0495489078161774
Disease Target Count Z-score Confidence
Cancer 2346 3.737 1.9
Craniofrontonasal syndrome 13 3.06 1.5

Expression

Synonym

Accession P52799 Q5JV56
Symbols HTKL
EPLG5
Htk-L
LERK5

Gene

PDB

2WO2   3GXU   2HLE   2I85   2VSK   2VSM   4UF7  

  Ortholog (14)

Gene RIF (72)

PMID Text
26754526 Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals.
26277777 Together, these findings suggest that CCL2, RARRES2 and EFNB2 are host cell factors involved in respiratory syncytial virus replication.
26212082 increased notably in preeclampsia endothelial progenitor cells and placenta
25825759 Molecular recognition of human ephrinB2 cell surface receptor by an emergent African henipavirus.
25807892 EfnB2 is an essential regulator of endothelial cell death and vessel pruning. This regulation depends upon phosphotyrosine-EfnB2 signaling repressing JNK3 activity via STAT1.
25748802 role in maternal spiral artery remodeling in first trimester
25724897 Human ephrin-B2 is poorly cleaved by KLK4 while the homologous mouse is not.
25434750 Results suggest that ephrinB2 may function as a colorectal cancer cells growth stimulator.
24634162 These genes may be potential biomarkers for identification of subclinical lymph node involvement in papillary thyroid carcinoma (PTC)
24615845 Data suggest that fusion of Nipah viruses with host cells is facilitated by two of viral membrane proteins, the G protein and the F protein; G head domain binds to human ephrins B2 and B3 altering conformational density of entire G head domain.
More...

AA Sequence

MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTV      1 - 70
GQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNG     71 - 140
SLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDG    141 - 210
NSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGN    211 - 280
NNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV                     281 - 333
//

Text Mined References (108)

PMID Year Title
26754526 2016 Interrogating cellular fate decisions with high-throughput arrays of multiplexed cellular communities.
26277777 2015 Identification of CCL2, RARRES2 and EFNB2 as host cell factors that influence the multistep replication of respiratory syncytial virus.
26268439 2015 p75(NTR)-dependent activation of NF-?B regulates microRNA-503 transcription and pericyte-endothelial crosstalk in diabetes after limb ischaemia.
26212082 2015 The role of Delta-like 4 ligand/Notch-ephrin-B2 cascade in the pathogenesis of preeclampsia by regulating functions of endothelial progenitor cell.
25825759 2015 Molecular recognition of human ephrinB2 cell surface receptor by an emergent African henipavirus.
25807892 2015 EphrinB2 controls vessel pruning through STAT1-JNK3 signalling.
25748802 2015 Ephrin-B2 mediates trophoblast-dependent maternal spiral artery remodeling in first trimester.
25724897 2015 Murine, but not human, ephrin-B2 can be efficiently cleaved by the serine protease kallikrein-4: implications for xenograft models of human prostate cancer.
25434750 2015 Effects of ephrinB2 gene siRNA on the biological behavior of human colorectal cancer cells.
24634162 2015 Overexpression of EphB4, EphrinB2, and epidermal growth factor receptor in papillary thyroid carcinoma: A pilot study.
More...