Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.11
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P52798 C9JHJ8 G3XAK2 O95457 Q5SR71 Q6FI57
Symbols EFL4
EPLG4
LERK4

Gene

Gene RIF (8)

PMID Text
25070915 The present study provides evidence that microglia upregulates endothelial ephrin-A3 and ephrin-A4 to facilitate in vitro angiogenesis of brain endothelial cells, which is mediated by microglia-released TNF-alpha.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
20643727 Observational study of gene-disease association. (HuGE Navigator)
20071790 The cytoplasmic pattern of ephrin A4 could identify a subgroup of primary osteosarcoma patients with a high liability for progression, poor prognosis, and inferior response to chemotherapy.
19828693 EFNA4-EphA2 interactions are involved in Chronic lymphocytic leukemia cell trafficking between blood and the tissues
18819711 CLL B-cells showed a more heterogeneous Eph/EFN profile, specially EFNA4, EphB6 and EphA10. EphB6 and EFNA4 were further related with the clinical course of CLL.
16540516 This provides genetic evidence that Twist1, Msx2 and Efna4 function together in boundary formation and the pathogenesis of coronal synostosis.
12030849 Characterization of the promoter

AA Sequence

MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP      1 - 70
ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES     71 - 140
SGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL             141 - 201
//

Text Mined References (31)

PMID Year Title
25070915 2014 Ephrin-A3 and ephrin-A4 contribute to microglia-induced angiogenesis in brain endothelial cells.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22708584 2012 Primer-BLAST: a tool to design target-specific primers for polymerase chain reaction.
20643727 2010 Prevalence and complications of single-gene and chromosomal disorders in craniosynostosis.
20071790 Ephrin A4 expression in osteosarcoma, impact on prognosis, and patient outcome.
19828693 2009 An impaired transendothelial migration potential of chronic lymphocytic leukemia (CLL) cells can be linked to ephrin-A4 expression.
18819711 2009 Expression profile of Eph receptors and ephrin ligands in healthy human B lymphocytes and chronic lymphocytic leukemia B-cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16540516 2006 Cell mixing at a neural crest-mesoderm boundary and deficient ephrin-Eph signaling in the pathogenesis of craniosynostosis.
More...