Property Summary

NCBI Gene PubMed Count 32
PubMed Score 17.37
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP      1 - 70
ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES     71 - 140
SGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL             141 - 201
//

Text Mined References (32)

PMID Year Title