Property Summary

NCBI Gene PubMed Count 28
Grant Count 18
R01 Count 6
Funding $2,619,891.01
PubMed Score 24.98
PubTator Score 16.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (9)

PMID Text
25955218 Results show that EFNA3 serves as a tumor suppressor in malignant peripheral nerve sheath tumor cells and it may play a critical role in the FAK signaling and VEGF-associated tumor angiogenesis pathway.
25070915 The present study provides evidence that microglia upregulates endothelial ephrin-A3 and ephrin-A4 to facilitate in vitro angiogenesis of brain endothelial cells, which is mediated by microglia-released TNF-alpha.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
19823572 EphA3 mutants with constitutively-released kinase domains efficiently support shedding, even when their kinase is disabled. Our data suggest that this phosphorylation-activated conformational switch of EphA3 directly controls ADAM-mediated shedding.
19204726 Observational study of gene-disease association. (HuGE Navigator)
18417479 MicroRNA-210 modulates endothelial cell response to hypoxia and inhibits the receptor tyrosine kinase ligand Ephrin-A3.
17980912 Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions.
15901737 analysis of molecular surfaces in ephrin-A5 essential for a functional interaction with EphA3
12907451 EphA2/ephrin-A3 interactions may play a role in the localization and network of Langerhans cells in the epithelium and in the regulation of their trafficking.

AA Sequence

MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSG      1 - 70
VGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHA     71 - 140
GHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEK    141 - 210
SISGTSPKREHLPLAVGIAFFLMTFLAS                                              211 - 238
//

Text Mined References (29)

PMID Year Title
25955218 2015 Dissecting the roles of Ephrin-A3 in malignant peripheral nerve sheath tumor by TALENs.
25416956 2014 A proteome-scale map of the human interactome network.
25070915 2014 Ephrin-A3 and ephrin-A4 contribute to microglia-induced angiogenesis in brain endothelial cells.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
19823572 2009 Cytoplasmic relaxation of active Eph controls ephrin shedding by ADAM10.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18417479 2008 MicroRNA-210 modulates endothelial cell response to hypoxia and inhibits the receptor tyrosine kinase ligand Ephrin-A3.
17980912 2008 EphA and ephrin-A proteins regulate integrin-mediated T lymphocyte interactions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...