Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.80
PubTator Score 16.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.400 3.3e-05
Astrocytoma, Pilocytic -1.700 1.4e-09
atypical teratoid / rhabdoid tumor -1.400 1.5e-06
cutaneous lupus erythematosus -1.300 2.3e-02
ependymoma -1.200 3.1e-06
glioblastoma -1.300 2.3e-03
malignant mesothelioma 1.900 2.4e-07
medulloblastoma, large-cell -1.500 2.2e-04

Gene RIF (9)

AA Sequence

MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSG      1 - 70
VGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHA     71 - 140
GHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEK    141 - 210
SISGTSPKREHLPLAVGIAFFLMTFLAS                                              211 - 238
//

Text Mined References (30)

PMID Year Title